Recombinant Full Length Mouse Transmembrane 7 Superfamily Member 3(Tm7Sf3) Protein, His-Tagged
Cat.No. : | RFL19020MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane 7 superfamily member 3(Tm7sf3) Protein (Q9CRG1) (22-565aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (22-565) |
Form : | Lyophilized powder |
AA Sequence : | NSSDGFLEFSVGKFTYFVLSKSSPQEAVLRHISSNVTFLLFQIHSQYQNTTVSFTKTLLP STSGTGNDRGLVFILRPEQAVCTWYLETGDTKPVQSVALTLSYSERDPIPGGCNLEFDLD IDPNLYLDYNFFETTIKFAPANIGYARATEPPPCDVSTSRESRWRLRYDVYQYFLPEGDL TEASLLHHLQRMAQVAQVKASAIKVATLTADDKTAVSFSSLPGQGVIYNVIVWDPSLNTS AAYVPVHTYACSFESVDGNCASPGRVSTKVFSTLFALLGLFVCFFGHRFWKTDLFFVGFI FLGFFFYILITRLTPLQYDVRLALTAVAGSFGGLLLVASWWRFGILTLCMLCVGLVLGFL VSSGTFFTPLGNLNVFHDDGVFWVTFSCIALLVPVIFMGCLRILNILACGVVGSYSVVLA VNSYMFTSLSYITLNVLRRALNTDFRGAFIRVPFQTNDYIILAVWGMLAVSGITLQIRRE RGQPPFPPHPYKLWKQERERRVTNILDPSHHIPPLRERLYGRVARIKELFQKEQPAGERT PLLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tm7sf3 |
Synonyms | Tm7sf3; Transmembrane 7 superfamily member 3; NARP1 |
UniProt ID | Q9CRG1 |
◆ Recombinant Proteins | ||
MGME1-1239H | Recombinant Human MGME1 Protein, MYC/DDK-tagged | +Inquiry |
Eef1akmt1-2734M | Recombinant Mouse Eef1akmt1 Protein, Myc/DDK-tagged | +Inquiry |
RFL18140RF | Recombinant Full Length Rickettsia Typhi Protein Translocase Subunit Secd(Secd) Protein, His-Tagged | +Inquiry |
ACOX2-43H | Recombinant Human ACOX2 Protein, His&GST-tagged | +Inquiry |
Klhl22-3714M | Recombinant Mouse Klhl22 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
Lectin-1825P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Fluorescein labeled | +Inquiry |
Lipoproteins-13H | Natve Human Lipoproteins, Very Low Density | +Inquiry |
LDL-399H | Native Human Low Density Lipoprotein, Oxidized | +Inquiry |
Heart-005H | Human Heart Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNNI3-1803HCL | Recombinant Human TNNI3 cell lysate | +Inquiry |
NCI-H522-042WCY | Human Non-small Cell Lung Adenocarcinoma NCI-H522 Whole Cell Lysate | +Inquiry |
ROM1-2253HCL | Recombinant Human ROM1 293 Cell Lysate | +Inquiry |
IGF1R-2928HCL | Recombinant Human IGF1R cell lysate | +Inquiry |
PXMP2-2652HCL | Recombinant Human PXMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tm7sf3 Products
Required fields are marked with *
My Review for All Tm7sf3 Products
Required fields are marked with *
0
Inquiry Basket