Recombinant Full Length Human Transmembrane 7 Superfamily Member 3(Tm7Sf3) Protein, His-Tagged
Cat.No. : | RFL16951HF |
Product Overview : | Recombinant Full Length Human Transmembrane 7 superfamily member 3(TM7SF3) Protein (Q9NS93) (22-570aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (22-570) |
Form : | Lyophilized powder |
AA Sequence : | AEVFGNSSEGLIEFSVGKFRYFELNRPFPEEAILHDISSNVTFLIFQIHSQYQNTTVSFS PTLLSNSSETGTASGLVFILRPEQSTCTWYLGTSGIQPVQNMAILLSYSERDPVPGGCNL EFDLDIDPNIYLEYNFFETTIKFAPANLGYARGVDPPPCDAGTDQDSRWRLQYDVYQYFL PENDLTEEMLLKHLQRMVSVPQVKASALKVVTLTANDKTSVSFSSLPGQGVIYNVIVWDP FLNTSAAYIPAHTYACSFEAGEGSCASLGRVSSKVFFTLFALLGFFICFFGHRFWKTELF FIGFIIMGFFFYILITRLTPIKYDVNLILTAVTGSVGGMFLVAVWWRFGILSICMLCVGL VLGFLISSVTFFTPLGNLKIFHDDGVFWVTFSCIAILIPVVFMGCLRILNILTCGVIGSY SVVLAIDSYWSTSLSYITLNVLKRALNKDFHRAFTNVPFQTNDFIILAVWGMLAVSGITL QIRRERGRPFFPPHPYKLWKQERERRVTNILDPSYHIPPLRERLYGRLTQIKGLFQKEQP AGERTPLLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TM7SF3 |
Synonyms | TM7SF3; Transmembrane 7 superfamily member 3; Seven span transmembrane protein |
UniProt ID | Q9NS93 |
◆ Recombinant Proteins | ||
RPLS-3258S | Recombinant Staphylococcus epidermidis ATCC 12228 RPLS protein, His-tagged | +Inquiry |
PENKA-10436Z | Recombinant Zebrafish PENKA | +Inquiry |
UTS2B-11630Z | Recombinant Zebrafish UTS2B | +Inquiry |
NLRP3-01HE | Recombinant Human NLRP3 Protein, His-tagged | +Inquiry |
ITPK1-4950H | Recombinant Human ITPK1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
C3-8092H | Native Human Plasma COMPLEMENT C (C3) | +Inquiry |
F2-5402P | Native Porcine Coagulation Factor II (thrombin) | +Inquiry |
C4BPA-100H | Native Human C4a Anaphylatoxin (Not Recombinant) | +Inquiry |
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
TWF1-633HCL | Recombinant Human TWF1 293 Cell Lysate | +Inquiry |
CDH16-2146HCL | Recombinant Human CDH16 cell lysate | +Inquiry |
CCDC92-164HCL | Recombinant Human CCDC92 lysate | +Inquiry |
TMEM183B-980HCL | Recombinant Human TMEM183B 293 Cell Lysate | +Inquiry |
PTPLAD1-1435HCL | Recombinant Human PTPLAD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TM7SF3 Products
Required fields are marked with *
My Review for All TM7SF3 Products
Required fields are marked with *
0
Inquiry Basket