Recombinant Full Length Mouse Translocator Protein 2(Tspo2) Protein, His-Tagged
Cat.No. : | RFL28813MF |
Product Overview : | Recombinant Full Length Mouse Translocator protein 2(Tspo2) Protein (Q9CRZ8) (1-162aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-162) |
Form : | Lyophilized powder |
AA Sequence : | MQLQGPVFVGVPLLGPILICMLIHQPSSRCEDERKLPWCPPHKVILLVWVTIYSVMGYAS YLVWKELGGGFRWPLALPLGLYSFQLALSWTFLVLFLAADSPGLALLDLLLLYGLVASLV FIWQPINKLAALLLLPYLAWLTVTTAITYRLWRDSLCPTYQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tspo2 |
Synonyms | Tspo2; Bzrpl1; Translocator protein 2; Peripheral-type benzodiazepine receptor-like protein 1 |
UniProt ID | Q9CRZ8 |
◆ Recombinant Proteins | ||
TBC1D16-1585Z | Recombinant Zebrafish TBC1D16 | +Inquiry |
FLCN-4828HF | Recombinant Full Length Human FLCN Protein, GST-tagged | +Inquiry |
ADAT3-1270H | Recombinant Human ADAT3 | +Inquiry |
HPRT1-5122H | Recombinant Human HPRT1 protein, His-tagged | +Inquiry |
COLEC10-3394C | Recombinant Chicken COLEC10 | +Inquiry |
◆ Native Proteins | ||
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
LRP1-18H | Native Human Intermediate Density Lipoproteins Protein | +Inquiry |
F10-290M | Active Native Mouse Factor X | +Inquiry |
Lung-017H | Human Lung Lysate, Total Protein | +Inquiry |
F13A1-1881H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHMT1-1855HCL | Recombinant Human SHMT1 293 Cell Lysate | +Inquiry |
PITRM1-1357HCL | Recombinant Human PITRM1 cell lysate | +Inquiry |
NUDT9-3640HCL | Recombinant Human NUDT9 293 Cell Lysate | +Inquiry |
CASP4-7837HCL | Recombinant Human CASP4 293 Cell Lysate | +Inquiry |
KLHL7-4906HCL | Recombinant Human KLHL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tspo2 Products
Required fields are marked with *
My Review for All Tspo2 Products
Required fields are marked with *
0
Inquiry Basket