Recombinant Full Length Mouse Translocating Chain-Associated Membrane Protein 2(Tram2) Protein, His-Tagged
Cat.No. : | RFL29097MF |
Product Overview : | Recombinant Full Length Mouse Translocating chain-associated membrane protein 2(Tram2) Protein (Q924Z5) (1-370aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-370) |
Form : | Lyophilized powder |
AA Sequence : | MAFRRRTKSYPLFSQEFIIHNHADIGFCLVLCVLIGLMFEVTAKTAFLFILPQYNISVPT ADSETVHYHYGPKDLVTILFYVVITIIFHAVVQEYILDKISKRLHLSKVKHSKFNESGQL LVFHLSAVAWCFYVIVTEGYLTNPRSLWEDYPHVYLSFQVKFFYLGQLAYWLHSLPELYF QKVRKEEVPRQLQYICLYLLHITGAYLLNLSRLGLILLLLQYSTEALFHMARLFHFADEN NERLFNAWAAVFGVTRLFILTLAVLTIGFGLARVENQVFDPEKGNFNTLPCRLGMLLLVC VAQAWLMWRFIHSQLRHWREYWKEQSAKRRVSAVPRPPAKLLKREPGYHENGVVKAENGT SSRTKKLKSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tram2 |
Synonyms | Tram2; Translocating chain-associated membrane protein 2 |
UniProt ID | Q924Z5 |
◆ Recombinant Proteins | ||
POLD2-3277H | Recombinant Human POLD2 protein, His-tagged | +Inquiry |
SGR-RS18325-783S | Recombinant Streptomyces griseus subsp. griseus NBRC 13350 SGR_RS18325 protein, His-tagged | +Inquiry |
NSP9-4440V | Recombinant 2019-nCoV NSP9 protein, 10xHis-tagged | +Inquiry |
EDAR-3049H | Recombinant Human EDAR Protein, GST-tagged | +Inquiry |
GMPPB-3749M | Recombinant Mouse GMPPB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PeptideD-724E | Native Ebola virus Delta Peptide | +Inquiry |
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
FDP-Y-52H | Native Human Fibrinogen Degrading Product-Y | +Inquiry |
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
SOD1-102B | Active Native Bovine SOD, modified | +Inquiry |
◆ Cell & Tissue Lysates | ||
WBP11-1920HCL | Recombinant Human WBP11 cell lysate | +Inquiry |
GPR146-5797HCL | Recombinant Human GPR146 293 Cell Lysate | +Inquiry |
BCHE-2196HCL | Recombinant Human BCHE cell lysate | +Inquiry |
ASNS-8650HCL | Recombinant Human ASNS 293 Cell Lysate | +Inquiry |
SRSF1-1910HCL | Recombinant Human SFRS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tram2 Products
Required fields are marked with *
My Review for All Tram2 Products
Required fields are marked with *
0
Inquiry Basket