Recombinant Full Length Mouse Tetraspanin-6(Tspan6) Protein, His-Tagged
Cat.No. : | RFL29900MF |
Product Overview : | Recombinant Full Length Mouse Tetraspanin-6(Tspan6) Protein (O70401) (1-245aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-245) |
Form : | Lyophilized powder |
AA Sequence : | MASPSRRLQTKPVITCLKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIGTGTVIILLGTFGCFATCRTSAWMLKLYAMFLTLIFLVELVAAIVGFVFRHEIKN SFKSNYENALKEYNSTGDYRSEAVDKIQSTLHCCGVTNYGDWKGTNYYSETGFPKSCCKL EGCYPQRDADKVNEEGCFIKVMTTIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tspan6 |
Synonyms | Tspan6; Tm4sf6; Tetraspanin-6; Tspan-6; Transmembrane 4 superfamily member 6 |
UniProt ID | O70401 |
◆ Recombinant Proteins | ||
PGSE-2970B | Recombinant Bacillus subtilis PGSE protein, His-tagged | +Inquiry |
CPT1C-1578R | Recombinant Rat CPT1C Protein | +Inquiry |
MARK4-5375M | Recombinant Mouse MARK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINB10-5340R | Recombinant Rat SERPINB10 Protein | +Inquiry |
Cd27-3273MF | Recombinant Mouse Cd27 Protein, His-tagged, FITC conjugated | +Inquiry |
◆ Native Proteins | ||
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
PIV2-19 | Native Parainfluenza Virus Type 2 Antigen | +Inquiry |
Troponin-18H | Native Human Cardiac Troponin complex | +Inquiry |
eCG-01E | Active Native Equine Gonadotropin protein | +Inquiry |
Lectin-1827P | Active Native Pisum Sativum Agglutinin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDCD1-001RCL | Recombinant Rat PDCD1 cell lysate | +Inquiry |
MFAP2-4352HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
C5orf45-8009HCL | Recombinant Human C5orf45 293 Cell Lysate | +Inquiry |
SEH1L-1986HCL | Recombinant Human SEH1L 293 Cell Lysate | +Inquiry |
Lung-755B | Bovine Lung Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Tspan6 Products
Required fields are marked with *
My Review for All Tspan6 Products
Required fields are marked with *
0
Inquiry Basket