Recombinant Full Length Mouse Tetraspanin-17(Tspan17) Protein, His-Tagged
Cat.No. : | RFL3058MF |
Product Overview : | Recombinant Full Length Mouse Tetraspanin-17(Tspan17) Protein (Q9D7W4) (1-270aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-270) |
Form : | Lyophilized powder |
AA Sequence : | MPGKHQQFQDPEVGCCGKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISALTDLGG LDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDW IRDQLNLFINNNVKAYRDDLDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRE RCGVPFSCCVRDPAEDVLNTQCGYDIRLKLELEQEGSIYTKGCVGQFEKWLQDNLIVVAG VLVGIALLQIFGLCLAQNLVSDIKAVKANW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tspan17 |
Synonyms | Tspan17; Fbxo23; Tm4sf17; Tetraspanin-17; Tspan-17; F-box only protein 23; Tetraspan protein SB134; Transmembrane 4 superfamily member 17 |
UniProt ID | Q9D7W4 |
◆ Recombinant Proteins | ||
TSPAN17-3456H | Recombinant Human TSPAN17, His-tagged | +Inquiry |
RFL3058MF | Recombinant Full Length Mouse Tetraspanin-17(Tspan17) Protein, His-Tagged | +Inquiry |
TSPAN17-6621Z | Recombinant Zebrafish TSPAN17 | +Inquiry |
RFL12914BF | Recombinant Full Length Bovine Tetraspanin-17(Tspan17) Protein, His-Tagged | +Inquiry |
TSPAN17-5000R | Recombinant Rhesus monkey TSPAN17 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPAN17-710HCL | Recombinant Human TSPAN17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tspan17 Products
Required fields are marked with *
My Review for All Tspan17 Products
Required fields are marked with *
0
Inquiry Basket