Recombinant Full Length Mouse Serine Palmitoyltransferase 2(Sptlc2) Protein, His-Tagged
Cat.No. : | RFL36607MF |
Product Overview : | Recombinant Full Length Mouse Serine palmitoyltransferase 2(Sptlc2) Protein (P97363) (1-560aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-560) |
Form : | Lyophilized powder |
AA Sequence : | MRPEPGGCCCRRPMRANGCVKNGEVRNGYLRSSTATVAAAGQIHHVTENGGLYKRPFNEA FEETPMLVAVLTYVGYGVLTLFGYLRDFLRHWRIEKCHHATEREEQKDFVSLYQDFENFY TRNLYMRIRDNWNRPICSVPGAKVDIMERKSHDYNWSFKYTGNIIKGVINMGSYNYLGFA RNTGSCQEAAAEVLKEYGAGVCSTRQEIGNLDKHEELEKLVARFLGVEAAMTYGMGFATN SMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQPR TRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVDY FGLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSMSPPVMEQIITS MKCIMGQDGTSLGKECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAF GREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRH RLVPLLDRPFDETTYEETED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sptlc2 |
Synonyms | Sptlc2; Lcb2; Serine palmitoyltransferase 2; Long chain base biosynthesis protein 2; LCB 2; Long chain base biosynthesis protein 2a; LCB2a; Serine-palmitoyl-CoA transferase 2; SPT 2 |
UniProt ID | P97363 |
◆ Recombinant Proteins | ||
SPTLC2-1622C | Recombinant Chicken SPTLC2 | +Inquiry |
RFL26324HF | Recombinant Full Length Human Serine Palmitoyltransferase 2(Sptlc2) Protein, His-Tagged | +Inquiry |
SPTLC2-15956M | Recombinant Mouse SPTLC2 Protein | +Inquiry |
SPTLC2-8695M | Recombinant Mouse SPTLC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Sptlc2-679M | Recombinant Mouse Sptlc2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPTLC2-1484HCL | Recombinant Human SPTLC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sptlc2 Products
Required fields are marked with *
My Review for All Sptlc2 Products
Required fields are marked with *
0
Inquiry Basket