Recombinant Full Length Mouse Selection And Upkeep Of Intraepithelial T-Cells Protein 7(Skint7) Protein, His-Tagged
Cat.No. : | RFL27555MF |
Product Overview : | Recombinant Full Length Mouse Selection and upkeep of intraepithelial T-cells protein 7(Skint7) Protein (A7XV04) (25-394aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-394) |
Form : | Lyophilized powder |
AA Sequence : | EKLRVTTPTRHLLARVGGQAELSCQVIPPHSVMHMEVRWFRSGHSQPVYLYRGGHKMSEE AAPEYANRTEFVKEAIGEGKVSLRIHNINILDDGPYQCSFNGSGFIDAAIMNLNVTAVGL ETEIHVQAPDADGVMVECNSGGWFPRPQMEWRDSKGATLPHSLKSYSQDEARFFYMKMTL LLTNMSHGSIICCIFNPVTGEEKQTSIILANELFNRDRIWMESLASIVWIMLSVYILYII CFYWRTGCASGCLSKCFCVVTSWPVQIVHLLFCTGTFFAIYLPHRSRVSLSDPQFPLYNN WITELLFVILFLTICFALPIILLFIQFQFTSLTKWEKNKDGIMDQPRLGKAHETSSLYRK KTGKSWEQEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Skint7 |
Synonyms | Skint7; Selection and upkeep of intraepithelial T-cells protein 7; Skint-7 |
UniProt ID | A7XV04 |
◆ Native Proteins | ||
CST3-8100H | Native Human Cystatin C (Cystatin 3) | +Inquiry |
CAPN2-350B | Native Bovine CAPN2 | +Inquiry |
SOD1-101B | Active Native Bovine SOD | +Inquiry |
C3a-08H | Native Human Complement C3 alpha protein | +Inquiry |
SERPING1-97H | Active Native Human C1 Esterase Inhibitor (C1-INH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHANK2-AS3-8333HCL | Recombinant Human C11orf76 293 Cell Lysate | +Inquiry |
GATAD1-6008HCL | Recombinant Human GATAD1 293 Cell Lysate | +Inquiry |
MRPS18C-4147HCL | Recombinant Human MRPS18C 293 Cell Lysate | +Inquiry |
RPA3-2241HCL | Recombinant Human RPA3 293 Cell Lysate | +Inquiry |
TFPT-665HCL | Recombinant Human TFPT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Skint7 Products
Required fields are marked with *
My Review for All Skint7 Products
Required fields are marked with *
0
Inquiry Basket