Recombinant Full Length Mouse Selection And Upkeep Of Intraepithelial T-Cells Protein 10(Skint10) Protein, His-Tagged
Cat.No. : | RFL1147MF |
Product Overview : | Recombinant Full Length Mouse Selection and upkeep of intraepithelial T-cells protein 10(Skint10) Protein (A7TZG1) (29-330aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (29-330) |
Form : | Lyophilized powder |
AA Sequence : | LDIQINIQVPDTEGVLLECTSGSLIPPAEMTWRDSKGNIIPHSTTFDSQDRAGLLYLKSS ILLKNRVQSPITCSIYNVTTNREKKRSVVLPDILFKSEYMSLMSNKFSCPLTYLFIIIFL NCLKGMLDFCCLKGKPVYFRELINKIKEVLNIKMRACCTLIWEFLLIVLYIAFLPFYLKF RSRASILDDAYPLHSNWLWDICIVLSVLMIFFTGLSLFLLWTLNCYGQMSYLPSMSMDLS KHDFEQNSSKSSEFQENYDVSCEIFLGTFEETIFSQHQESCIEDSFNPLQPLRLDCSLNW KT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Skint10 |
Synonyms | Skint10; Selection and upkeep of intraepithelial T-cells protein 10; Skint-10 |
UniProt ID | A7TZG1 |
◆ Native Proteins | ||
FABP-175C | Native Guinea Pig Fatty acid Binding Protein | +Inquiry |
CPB2-27270TH | Native Human CPB2 | +Inquiry |
HB-40C | Native Cattle Hemoglobin (HB) Protein | +Inquiry |
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
TF-143C | Native Chicken Serum Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSC22D3-723HCL | Recombinant Human TSC22D3 293 Cell Lysate | +Inquiry |
FAM108A3-6458HCL | Recombinant Human FAM108A3 293 Cell Lysate | +Inquiry |
ZSCAN4-9184HCL | Recombinant Human ZSCAN4 293 Cell Lysate | +Inquiry |
PIP4K2A-3175HCL | Recombinant Human PIP4K2A 293 Cell Lysate | +Inquiry |
PLA2G16-3143HCL | Recombinant Human PLA2G16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Skint10 Products
Required fields are marked with *
My Review for All Skint10 Products
Required fields are marked with *
0
Inquiry Basket