Recombinant Full Length Mouse Regulator Of Microtubule Dynamics Protein 3(Fam82A2) Protein, His-Tagged
Cat.No. : | RFL32458MF |
Product Overview : | Recombinant Full Length Mouse Regulator of microtubule dynamics protein 3(Fam82a2) Protein (Q3UJU9) (1-470aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-470) |
Form : | Lyophilized powder |
AA Sequence : | MSRLGALGGSRAGLGLLLGTAAGLGFLCVLYSQRWKRTQRHGRSHSLPNSLDYAQASERG RQVTQFRAIPGEAGDAAILPSLSQEGQEKVLDRLDFVLTSLMALRREVEELQRSLQGLAG EIVGEVRSHIEENQRVARRRRFPFARERSDSTGSSSVYFTASSGAALTDAESEGGYTTAN AESDYERDSDKESGDAEDEVSCETVRMGRKDSLDLDVEAASSPAAAALEEDDSSGREDVQ LVLLQADELHQGSKQDKREGFQLLLNNKLAYGSRQDFLWRLARAYSDMSDLTEEESGKKS YALNGKEEAEAALKKGDESAACHLWYAVLCGQLAEHEGISKRIQSGFSFKEHVDKAIELQ PEDPRGHFLLGRWCYQVSHLNWLEKKTATALFESPLSATVQDALQSFLKAEELQPGFSKA GRVYISKCYRELGKNSEARKWMKLAQELPDVTNEDSAFQKDLEELEVILG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rmdn3 |
Synonyms | Rmdn3; Fam82a2; Fam82c; Regulator of microtubule dynamics protein 3; RMD-3; mRMD-3; Protein FAM82A2; Protein FAM82C |
UniProt ID | Q3UJU9 |
◆ Native Proteins | ||
FABP3-09M | Native Mouse FABP3 protein | +Inquiry |
C5-10540H | Active Native Human C5 | +Inquiry |
calc1-8308S | Native Salmon calc1 | +Inquiry |
ACOD-35 | Active Native acyl-CoA oxidase | +Inquiry |
GOx-30A | Active Native Aspergillus Niger Glucose Oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHA4-2136MCL | Recombinant Mouse EPHA4 cell lysate | +Inquiry |
TMEM167B-993HCL | Recombinant Human TMEM167B 293 Cell Lysate | +Inquiry |
NLGN4Y-3807HCL | Recombinant Human NLGN4Y 293 Cell Lysate | +Inquiry |
Postcentral Gyrus-397H | Human Postcentral Gyrus (Alzheimers Disease) Lysate | +Inquiry |
CRLF2-7275HCL | Recombinant Human CRLF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rmdn3 Products
Required fields are marked with *
My Review for All Rmdn3 Products
Required fields are marked with *
0
Inquiry Basket