Recombinant Full Length Phosphatidylethanolamine:Ceramide Ethanolaminephosphotransferase(Sls2) Protein, His-Tagged
Cat.No. : | RFL561TF |
Product Overview : | Recombinant Full Length Phosphatidylethanolamine:ceramide ethanolaminephosphotransferase(SLS2) Protein (B3A0M0) (1-323aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Trypanosoma brucei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-323) |
Form : | Lyophilized powder |
AA Sequence : | MAVPPVEMYSGSFWNRMRKPLPLRTQVIRFTVVFVIVSFILVVALQITHERMPDPKVTKP LPDLGFELLTKVPGMYVLADCCIGFLNILSVFTAFKLYLLHRHCVGSGEPELPCNIPGVS RFFLSVWLCKENCRIELRNIHTIAWIRFITSYALLLLSRSIIMVVTSLPNPDDLCQNPPK IENRVKDILLTVLTAGAGSIHCGDLMYSGHTVILTLHLMFHWIYGAMVHWSFRPVVTVVA IFGYYCIVASRFHYTDDVLVAIYLTIATFIAVGHNADGAPWQLQLFIRWWPCCGANSREV AEDGVPVAIVIKNEEMMNFEGKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLS2 |
Synonyms | SLS2; Phosphatidylethanolamine:ceramide ethanolaminephosphotransferase; TbSLS2; Ethanolamine-phosphorylceramide synthase; EPC synthase; Sphingolipid synthase |
UniProt ID | B3A0M0 |
◆ Recombinant Proteins | ||
OTUD7B-4835Z | Recombinant Zebrafish OTUD7B | +Inquiry |
MTMR7-6544HF | Recombinant Full Length Human MTMR7 Protein, GST-tagged | +Inquiry |
ADIPOR1-2351H | Recombinant Human ADIPOR1 protein, His-Flag-tagged | +Inquiry |
CD59-5370H | Recombinant Human CD59 protein, His-tagged | +Inquiry |
ECD-680H | Recombinant Human ECD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Actin-21R | Native Rabbit Actin Protein | +Inquiry |
Hyaluronidase-35O | Active Native Ovine Hyaluronidase, 300U/mg | +Inquiry |
FGB-56R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
GFP-36B | Native Bovine GFP | +Inquiry |
ApoB-3556H | Native Human ApoB | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM177-984HCL | Recombinant Human TMEM177 293 Cell Lysate | +Inquiry |
FMO2-6183HCL | Recombinant Human FMO2 293 Cell Lysate | +Inquiry |
SLC6A3-1637HCL | Recombinant Human SLC6A3 cell lysate | +Inquiry |
IFNA5-2932HCL | Recombinant Human IFNA5 cell lysate | +Inquiry |
LINGO1-4728HCL | Recombinant Human LINGO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLS2 Products
Required fields are marked with *
My Review for All SLS2 Products
Required fields are marked with *
0
Inquiry Basket