Recombinant Full Length Mouse Protein Odr-4 Homolog(Odr4) Protein, His-Tagged
Cat.No. : | RFL30085MF |
Product Overview : | Recombinant Full Length Mouse Protein odr-4 homolog(Odr4) Protein (Q4PJX1) (1-447aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-447) |
Form : | Lyophilized powder |
AA Sequence : | MGRTYIVEETVGQYLSSINLQGKPFVSGLLIGQCSSQKDYVILATRTPPKEEQNDKVKQP RAKLDNLDEEWATEHASQVSRMLPGGLVVLGIFIITTLELADDFQNALRRLIFSMEKSMS RKRLWDVTEDEVSERVTLHICSSTKKISCRTYDVQDPKSSARPADWKYQSRVSASWLSLD CTVHVNIHIPLSATSVSYTLEKNTKSGLTRWAKQIENGVYLINGQVKGNDCDLLEGQKKS RGNTQATAHSFDVRVLTQLLLNSDHRSTATVQICSGSVNLRGNVKCRAYIHSNRPKVKDA VQAVKRDILNTVADRCEILFEDLLLNEIPEKKNYELPQRVFVPLPGSTVMLCDYKFGDES AEEIRDHFSEMLDHEIQIEDLEIAEEVNTACMTSSVNSEASLTNTSEEQPEQPKKTIGVK IQQNIGVIAALAVAVLAAGISFHYFSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Odr4 |
Synonyms | Odr4; Protein odr-4 homolog; mODR-4 |
UniProt ID | Q4PJX1 |
◆ Recombinant Proteins | ||
NPEPPS-2500H | Recombinant Human NPEPPS Protein, His-tagged | +Inquiry |
H5N1V07-236I | Recombinant H5N1 (A/Vietnam HN31242/2007) H5N1V07 protein, His-tagged | +Inquiry |
KLF4-6294Z | Recombinant Zebrafish KLF4 | +Inquiry |
NME7-48H | Recombinant Human NME7, MYC/DDK-tagged | +Inquiry |
SPP1-5130H | Active Recombinant Human Secreted Phosphoprotein 1 | +Inquiry |
◆ Native Proteins | ||
Lectin-1804L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 649 labeled | +Inquiry |
FBb-16H | Native Human FBb protein | +Inquiry |
DD-170H | Active Native Human D-Dimer | +Inquiry |
RSV-09 | Native Respiratory Syncytial Virus (RSV) Antigen | +Inquiry |
Saporin-30S | Native Saponaria officinalis ribosome-inactivating Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRLF1-404HCL | Recombinant Human CRLF1 cell lysate | +Inquiry |
ZNF259-108HCL | Recombinant Human ZNF259 293 Cell Lysate | +Inquiry |
RAW 264.7-153M | RAW 264.7 Whole Cell Lysate | +Inquiry |
IL5RA-001MCL | Recombinant Mouse IL5RA cell lysate | +Inquiry |
KCNK12-948HCL | Recombinant Human KCNK12 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Odr4 Products
Required fields are marked with *
My Review for All Odr4 Products
Required fields are marked with *
0
Inquiry Basket