Recombinant Full Length Mouse Protein Dos(Dos) Protein, His-Tagged
Cat.No. : | RFL20323MF |
Product Overview : | Recombinant Full Length Mouse Protein Dos(Dos) Protein (Q66L44) (1-705aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-705) |
Form : | Lyophilized powder |
AA Sequence : | MATAAATTATVALTTSWDNATSRPTAEPDPILDNYVLLVVVMSLFVGGTLVVLSGVLLLC KRCWEVHQRFNRAMEEAEKTTTTYLDNGTHPIQDWAQFESDSSLFPDPDCRGEDPEGQDT ETERFLATSSTGRRVSFNEAALFEQSRKAQDKGRRYTLTEGDFHHLKNARLTHLHLPPLK IATIHECDSGEASAAATPHPATTSKDSLAIFQPPGKTLTGHSVGPSSALPGGPYNSVDFS EISPSTSSDSGEGISLDAGTRGAKAAGPETVPGEMGTGSSGSGTVLQFFTRLRRHASLDG ASPYFKVKKWKLEPSQRASSLDTRGSPKRHHFQRQRAASESMEQEGDVPHADFIQYIASA GDSVAFPPPRPFLASPTSPPPTLGRLEAAEAAGGASPETPPEHGISLGPEHAQQQDPQQE QDAEHAQCSYRDLWSLRASLELHAATASDHSSSGNDRDSVRSGDSSGSGSGGGGAAPAFP PPPESPPALRPKDGEARRLLQMDSGYASIEGRGAGDEVSELPAPARSPPRSPRAWPRRPR RDYSIDEKTDALFHEFLRHDPHFDDAPRHRTRAHPHTHARKQWQQRGRQHSDPGGARAAT PPGVARPTRAPLRRGDSVDCPPEGRALPITGDDPSIPVIEEEPGGGGGGCPGSGLCVEPA GALLDKLAASLDERLFSPRLAEPVASSQVLIVAAAAPTSPDHSPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cbarp |
Synonyms | Cbarp; Barp; Dos; R29144/1; Voltage-dependent calcium channel beta subunit-associated regulatory protein; Downstream of Stk11 protein |
UniProt ID | Q66L44 |
◆ Recombinant Proteins | ||
RGS4-1464HFL | Recombinant Full Length Human RGS4 Protein, C-Flag-tagged | +Inquiry |
DEFB4-4486M | Recombinant Mouse DEFB4 Protein | +Inquiry |
RFL5185SF | Recombinant Full Length Saccharomyces Cerevisiae Protein Ccc1(Ccc1) Protein, His-Tagged | +Inquiry |
HDVag-256V | Recombinant Hepatitis D Virus protein | +Inquiry |
Serpinf2-853M | Recombinant Mouse Serpinf2 protein(Met1-Lys491), His-tagged | +Inquiry |
◆ Native Proteins | ||
Hp1-1-195H | Native Human Haptoglobin 1-1 | +Inquiry |
Envelope-776W | Native purified West Nile Virus Envelope (E) Protein, His-tagged | +Inquiry |
ALPP-8005H | Native Human Placental Alkaline Phosphatase | +Inquiry |
ALPL-5324H | Active Native Human Alkaline Phosphatase | +Inquiry |
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTBD8-191HCL | Recombinant Human BTBD8 cell lysate | +Inquiry |
GTF2I-763HCL | Recombinant Human GTF2I cell lysate | +Inquiry |
MATR3-4447HCL | Recombinant Human MATR3 293 Cell Lysate | +Inquiry |
ZNF468-2031HCL | Recombinant Human ZNF468 cell lysate | +Inquiry |
UROC1-484HCL | Recombinant Human UROC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cbarp Products
Required fields are marked with *
My Review for All Cbarp Products
Required fields are marked with *
0
Inquiry Basket