Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 115(Gpr115) Protein, His-Tagged
Cat.No. : | RFL32258MF |
Product Overview : | Recombinant Full Length Mouse Probable G-protein coupled receptor 115(Gpr115) Protein (Q9D2L6) (20-698aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-698) |
Form : | Lyophilized powder |
AA Sequence : | SHSKPKTHRKDEDKFQISLQKHEFRPRQGKCDGLCSSSSSCNQSCPWNFRGEIVFTCNQN KWQKTIETCTSLSVDTLFQRIHPAASLSLASSSVFPMSLIGNAAPVHIGNVFQGIQKYCP EDYVCIVDAVKSSAVTSGNIAFIVELLKNISSNLQTSGIHDNVNWKKMKNYGKVANHILG PTAISNWAFIANKNASSDLLESVNSFAKKLQIQGKSESIVDELFIQTKGSRISHSSSEHS LSLSVPRYNATEDVLVVIEIPRQALQELSFNASQAIVVAFPTLGAILKEVHRPNTSLQKP IDDLILSLVLPEGLNEIILTFDKINKSQSTSSQCVSWDPATGQWDESPCTVMSDINSTVK CRCRHTKAVTSFSILMSSKPVKNTILNHITFIGLSISIFSLVLCLVIEAIVWSRVVVTEI SYMRHVCIVNIAVSLLTANVWFIIGSNFSANVQEDHKWCVAVTFLCHFFFLSLFFWMLFK ALLIVYGILVVFRRMMKSRMMAIGFAIGYGCPLVIAVITVTVTEPGEGYTRKDACWLNWN QTKALFAFAIPALAIVAVNLLVVLAVAINTQRPLIGSSKSQDMAIVFRISKNVAILTPLL GLTWGFGLTTLLEGVHLVFHIIFALLNAFQGFFILLFGTIMDHKIRDALRMRVSSLKGKS RAAEKVSLSPANGSRILNR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Adgrf4 |
Synonyms | Adgrf4; Gpr115; Adhesion G protein-coupled receptor F4; G-protein coupled receptor 115 |
UniProt ID | Q9D2L6 |
◆ Recombinant Proteins | ||
BRAF-26566TH | Recombinant Human BRAF | +Inquiry |
Osm-841M | Active Recombinant Mouse Osm Protein, His-tagged | +Inquiry |
SAP026A-028-2640S | Recombinant Staphylococcus aureus (strain: CM05, other: ST5-MRSA-mec I) SAP026A_028 protein, His-tagged | +Inquiry |
Abca9-8146R | Recombinant Rat Abca9 protein, His & T7-tagged | +Inquiry |
Il2-553M | Recombinant Mouse Il2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TPO-702H | Native Human Thyroid Peroxidase | +Inquiry |
APC-137 | Native Spirulina sp. Allophycocyanin protein | +Inquiry |
PIV1-18 | Native Parainfluenza Virus Type 1 Antigen | +Inquiry |
C6-55H | Native Human Complement C6 | +Inquiry |
LDL-1538H | Native Human Low-density lipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEPT3-1962HCL | Recombinant Human SEPT3 293 Cell Lysate | +Inquiry |
PSTPIP1-2732HCL | Recombinant Human PSTPIP1 293 Cell Lysate | +Inquiry |
Heart-841P | Pig Heart Membrane Lysate, Total Protein | +Inquiry |
CAMK2N2-144HCL | Recombinant Human CAMK2N2 lysate | +Inquiry |
Colon-93H | Human Colon Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Adgrf4 Products
Required fields are marked with *
My Review for All Adgrf4 Products
Required fields are marked with *
0
Inquiry Basket