Recombinant Full Length Mouse Probable Ergosterol Biosynthetic Protein 28(Orf11) Protein, His-Tagged
Cat.No. : | RFL33113MF |
Product Overview : | Recombinant Full Length Mouse Probable ergosterol biosynthetic protein 28(ORF11) Protein (Q9ERY9) (1-140aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-140) |
Form : | Lyophilized powder |
AA Sequence : | MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLS SVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVFGTAAPTVGVLAPLMVASFSILG MLVGLRYLEAEPVSRQKKRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Erg28 |
Synonyms | Erg28; Orf11; Ergosterol biosynthetic protein 28 homolog |
UniProt ID | Q9ERY9 |
◆ Recombinant Proteins | ||
Aldh3a1-571M | Recombinant Mouse Aldh3a1 Protein, MYC/DDK-tagged | +Inquiry |
RFL36759BF | Recombinant Full Length Putative Membrane Protein Yozs(Yozs) Protein, His-Tagged | +Inquiry |
Arhgef37-1693M | Recombinant Mouse Arhgef37 Protein, Myc/DDK-tagged | +Inquiry |
PON1-3301H | Recombinant Human PON1 protein, His-tagged | +Inquiry |
ADAM28-3002H | Recombinant Human ADAM28, His-tagged | +Inquiry |
◆ Native Proteins | ||
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
PROC-269B | Active Native Bovine Protein C | +Inquiry |
Endoproteinase Lys-C-85L | Native Lysobacter enzymogenes Endoproteinase Lys-C | +Inquiry |
TSH-108H | Active Native Human Thyroid Stimulating Hormone | +Inquiry |
VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
C12orf29-8324HCL | Recombinant Human C12orf29 293 Cell Lysate | +Inquiry |
CSTF2-414HCL | Recombinant Human CSTF2 cell lysate | +Inquiry |
DEF8-6992HCL | Recombinant Human DEF8 293 Cell Lysate | +Inquiry |
ZNF688-28HCL | Recombinant Human ZNF688 293 Cell Lysate | +Inquiry |
GLTP-5893HCL | Recombinant Human GLTP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Erg28 Products
Required fields are marked with *
My Review for All Erg28 Products
Required fields are marked with *
0
Inquiry Basket