Recombinant Full Length Mouse Potassium Voltage-Gated Channel Subfamily S Member 2(Kcns2) Protein, His-Tagged
Cat.No. : | RFL36683MF |
Product Overview : | Recombinant Full Length Mouse Potassium voltage-gated channel subfamily S member 2(Kcns2) Protein (O35174) (1-477aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-477) |
Form : | Lyophilized powder |
AA Sequence : | MTRQSLWDVSDTDVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCD DYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCS YSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNP GYSVLSRVFSVLSILVVLGSIITMCLNSLPDFQIPDSQGNPGEDPRFEIVEHFGIAWFTF ELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESSPTLANLGRVAQVLRLM RIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTIEKEENEGLAT IPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQ KQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLDDSLH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcns2 |
Synonyms | Kcns2; Potassium voltage-gated channel subfamily S member 2; Delayed-rectifier K(+ channel alpha subunit 2; Voltage-gated potassium channel subunit Kv9.2 |
UniProt ID | O35174 |
◆ Recombinant Proteins | ||
IQCF5-4591M | Recombinant Mouse IQCF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
FHIT-1530R | Recombinant Rhesus Macaque FHIT Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXA1-2518H | Recombinant Human FOXA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TGFBR3-698H | Active Recombinant Human TGFBR3, His-tagged, Biotinylated | +Inquiry |
LINGO1-349HFL | Recombinant Full Length Human LINGO1 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
ApoC-II-3558H | Native Human ApoC-II | +Inquiry |
SERPING1-73H | Native Human C1 Esterase inhibitor | +Inquiry |
KS-01G | Active Native Goat KS Protein | +Inquiry |
Immunoglobulin A1-77H | Native Human Immunoglobulin A1 | +Inquiry |
Collagen-48H | Native Human Collagen V | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBL1Y-1213HCL | Recombinant Human TBL1Y 293 Cell Lysate | +Inquiry |
GSK3A-5723HCL | Recombinant Human GSK3A 293 Cell Lysate | +Inquiry |
ISG15-5152HCL | Recombinant Human ISG15 293 Cell Lysate | +Inquiry |
IL17RA-1441RCL | Recombinant Rat IL17RA cell lysate | +Inquiry |
LARGE-4822HCL | Recombinant Human LARGE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Kcns2 Products
Required fields are marked with *
My Review for All Kcns2 Products
Required fields are marked with *
0
Inquiry Basket