Recombinant Full Length Human Phosphatidylserine Synthase 2(Ptdss2) Protein, His-Tagged
Cat.No. : | RFL2287HF |
Product Overview : | Recombinant Full Length Human Phosphatidylserine synthase 2(PTDSS2) Protein (Q9BVG9) (1-487aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-487) |
Form : | Lyophilized powder |
AA Sequence : | MRRGERRDAGGPRPESPVPAGRASLEEPPDGPSAGQATGPGEGRRSTESEVYDDGTNTFF WRAHTLTVLFILTCTLGYVTLLEETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRP HPAYWRFWLCVSVVYELFLIFILFQTVQDGRQFLKYVDPKLGVPLPERDYGGNCLIYDPD NETDPFHNIWDKLDGFVPAHFLGWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSE CWWDHWIMDVLVCNGLGIYCGMKTLEWLSLKTYKWQGLWNIPTYKGKMKRIAFQFTPYSW VRFEWKPASSLRRWLAVCGIILVFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGV AMREIYDFMDDPKPHKKLGPQAWLVAAITATELLIVVKYDPHTLTLSLPFYISQCWTLGS VLALTWTVWRFFLRDITLRYKETRWQKWQNKDDQGSTVGNGDQHPLGLDEDLLGPGVAEG EGAPTPN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTDSS2 |
Synonyms | PTDSS2; PSS2; Phosphatidylserine synthase 2; PSS-2; PtdSer synthase 2; Serine-exchange enzyme II |
UniProt ID | Q9BVG9 |
◆ Recombinant Proteins | ||
ADPRHL2-9440H | Recombinant Human ADPRHL2 protein, His-tagged | +Inquiry |
PDXKB-7337Z | Recombinant Zebrafish PDXKB | +Inquiry |
NAT10-645HFL | Recombinant Full Length Human NAT10 Protein, C-Flag-tagged | +Inquiry |
VSIR-839H | Recombinant Human VSIR Protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
RFL6401EF | Recombinant Full Length Escherichia Coli O81 Upf0114 Protein Yqha(Yqha) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
ASO-153H | Active Native Human Antistreptolysin O | +Inquiry |
SERPINC1-5487R | Native Rabbit Serpin Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
FABP-173C | Native Canine Fatty acid Binding Protein | +Inquiry |
TLN1-890T | Native Turkey TLN1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EXT1-6497HCL | Recombinant Human EXT1 293 Cell Lysate | +Inquiry |
ANGPTL7-769CCL | Recombinant Canine ANGPTL7 cell lysate | +Inquiry |
BAD-8529HCL | Recombinant Human BAD 293 Cell Lysate | +Inquiry |
RPP30-2179HCL | Recombinant Human RPP30 293 Cell Lysate | +Inquiry |
C9orf78-7925HCL | Recombinant Human C9orf78 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTDSS2 Products
Required fields are marked with *
My Review for All PTDSS2 Products
Required fields are marked with *
0
Inquiry Basket