Recombinant Full Length Mouse Neuromedin-U Receptor 2(Nmur2) Protein, His-Tagged
Cat.No. : | RFL14765MF |
Product Overview : | Recombinant Full Length Mouse Neuromedin-U receptor 2(Nmur2) Protein (Q8BZ39) (1-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-395) |
Form : | Lyophilized powder |
AA Sequence : | MGKLENASWIHDSLMKYLNSTEEYLAYLCGPKRSDLSLPVSVVYALIFVVGVIGNLLVCL VIARHQTLKTPTNYYLFSLAVSDLLVLLLGMPLEVYELWHNYPFLFGPVGCYFKTALFET VCFASILSVTTVSIERYVAIVHPFRAKLESTRRRALRILSLVWSFSVVFSLPNTSIHGIK FQQFPNGSSVPGSATCTVTKPIWVYNFIIQATSFLFYILPMTLISVLYYLMGLRLKRDES LEADKVTVNIHRPSRKSVTKMLFVLVLVFAICWTPFHVDRLFFSFVDEWTESLAAVFNLI HVVSGVFFYLSSAVNPIIYNLLSRRFRAAFRNVVSPSCKWCHPQHRPQGPPAQKVIFLTE CHLVELTEDAGPQFPCQSSIHNTQLTTVPCVEEVP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Nmur2 |
Synonyms | Nmur2; Neuromedin-U receptor 2; NMU-R2 |
UniProt ID | Q8BZ39 |
◆ Recombinant Proteins | ||
NSP3-4436V | Recombinant 2019-nCoV NSP3 protein, His-tagged | +Inquiry |
SPIN1-8646M | Recombinant Mouse SPIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCT4-3698H | Recombinant Human CCT4 protein, GST-tagged | +Inquiry |
RFL18384SF | Recombinant Full Length Sclerotinia Sclerotiorum Probable Endonuclease Lcl3(Lcl3) Protein, His-Tagged | +Inquiry |
WDR5-31543TH | Recombinant Human WDR5, His-tagged | +Inquiry |
◆ Native Proteins | ||
KLC-212H | Native Human Kappa Light Chain | +Inquiry |
COL3A1-001H | Native Human COL3A1 Protein | +Inquiry |
IgM-01C | Native Cow IgM Protein | +Inquiry |
IgG1-227H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
F10-5395R | Active Native Rat Coagulation Factor X | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRB-713HCL | Recombinant Human GLRB cell lysate | +Inquiry |
IL35-2904HCL | Recombinant Human IL35 cell lysate | +Inquiry |
LTBR-1052RCL | Recombinant Rat LTBR cell lysate | +Inquiry |
TADA2A-1280HCL | Recombinant Human TADA2A 293 Cell Lysate | +Inquiry |
GPRASP2-747HCL | Recombinant Human GPRASP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Nmur2 Products
Required fields are marked with *
My Review for All Nmur2 Products
Required fields are marked with *
0
Inquiry Basket