Recombinant Full Length Mouse Myelin Protein Zero-Like Protein 2(Mpzl2) Protein, His-Tagged
Cat.No. : | RFL28593MF |
Product Overview : | Recombinant Full Length Mouse Myelin protein zero-like protein 2(Mpzl2) Protein (O70255) (27-215aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-215) |
Form : | Lyophilized powder |
AA Sequence : | VEIYTSGALEAVNGTDVRLKCTFSSFAPVGDALTVTWNFRPRDGGREQFVFYYHMDPFRPMSGRFKDRVVWDGNPERYDVSILLWKLQFDDNGTYTCQVKNPPDVDGLVGTIRLSVVHTVPFSEIYFLAVAIGSACALMIIVVIVVVLFQHFRKKRWADRADKAEGTKSKEEEKLNQGNKVSVFVEDTD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mpzl2 |
Synonyms | Mpzl2; Eva; Eva1; Myelin protein zero-like protein 2; Epithelial V-like antigen 1 |
UniProt ID | O70255 |
◆ Recombinant Proteins | ||
MPZL2-5526H | Recombinant Human MPZL2 Protein, GST-tagged | +Inquiry |
MPZL2-1593M | Recombinant Mouse MPZL2 protein, hFc-tagged | +Inquiry |
MPZL2-3214H | Recombinant Human MPZL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Mpzl2-982M | Recombinant Mouse Mpzl2 Protein, MYC/DDK-tagged | +Inquiry |
RFL28593MF | Recombinant Full Length Mouse Myelin Protein Zero-Like Protein 2(Mpzl2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPZL2-4217HCL | Recombinant Human MPZL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mpzl2 Products
Required fields are marked with *
My Review for All Mpzl2 Products
Required fields are marked with *
0
Inquiry Basket