Recombinant Full Length Mouse Motile Sperm Domain-Containing Protein 2(Mospd2) Protein, His-Tagged
Cat.No. : | RFL2324MF |
Product Overview : | Recombinant Full Length Mouse Motile sperm domain-containing protein 2(Mospd2) Protein (Q9CWP6) (1-518aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-518) |
Form : | Lyophilized powder |
AA Sequence : | MAENNAQNKAKLISETRRRFEAEYVTEKSEKYDSRDVERLQQDDNWVESYLYWRHNVVDE TLKMLDESFQWRKEFSVNDLSESSIPRWLLELGGIYLHGYDKEGNKLFWIRVKYHIKDQK TIMDKKKLIAFWLERYAKRENGKPITVMFDMSETGLNSIDMDFVRFIINCFKVYYPKYLS KIVIFDMPWIMNAAFKIVKSWLGPEAVSLLKFTSKNEIQEYVSVEYLPPHMGGTDPFKYS YPPLVDDDFQTPLCENGPIASEDETSSKEDIEGDGKETLETISNEEPPALSEKSNPTESV SKKDENEKVDSKTKTFKKPLSVFKGPLLHISPAEELYFGSIESGEKKTLIVLTNVTKNIV AFKVRTTAPEKYRVKPSNSSCDPGASIDIIVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP AELSQFWKEVPRNKVMEHRLRCHTVESSKPNSLMLKDSISTMSDKTSEDLYLQLNRLLES NRKLEDQLQRSIWFQQLLLALTMVLLDFVVSFFYSLYN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mospd2 |
Synonyms | Mospd2; Motile sperm domain-containing protein 2 |
UniProt ID | Q9CWP6 |
◆ Recombinant Proteins | ||
ARL8B-788R | Recombinant Rat ARL8B Protein | +Inquiry |
RFL20082HF | Recombinant Full Length Uncharacterized Pe-Pgrs Family Protein Pe_Pgrs34(Pe_Pgrs34) Protein, His-Tagged | +Inquiry |
RFL36313MF | Recombinant Full Length Uncharacterized Protein Mb1311C (Mb1311C) Protein, His-Tagged | +Inquiry |
OR5K1-1697H | Recombinant Human OR5K1 | +Inquiry |
MIB1-5316H | Recombinant Human MIB1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LDL-404H | Native Human Low Density Lipoprotein, Oxidized, Biotin labeled | +Inquiry |
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
COL2A1-14B | Native Bovine COL2A1 Protein | +Inquiry |
IgM-338H | Native Horse IgM | +Inquiry |
IgA-3882M | Native Monkey Immunoglobulin A, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTTG1-2667HCL | Recombinant Human PTTG1 293 Cell Lysate | +Inquiry |
PHF21B-3229HCL | Recombinant Human PHF21B 293 Cell Lysate | +Inquiry |
Fetus-185M | Mouse Fetus (15 Day Fetus) Lysate | +Inquiry |
PPP2R1A-2926HCL | Recombinant Human PPP2R1A 293 Cell Lysate | +Inquiry |
MED22-4387HCL | Recombinant Human MED22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mospd2 Products
Required fields are marked with *
My Review for All Mospd2 Products
Required fields are marked with *
0
Inquiry Basket