Recombinant Full Length Mouse Membralin(Orf61) Protein, His-Tagged
Cat.No. : | RFL13486MF |
Product Overview : | Recombinant Full Length Mouse Membralin(ORF61) Protein (Q8CIV2) (1-574aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-574) |
Form : | Lyophilized powder |
AA Sequence : | MSEHAAAPGPGPNGGGGGGAAPVRGPRGPNLNPNPLINVRDRLFHALFFKMAVTYSRLFP PAFRRLFEFFVLLKALFVLFVLAYIHIVFSRSPINCLEHVRDRWPREGVLRVEVRHNSSR APVILQFCDGGLGGLELEPGGLELEEEELTVEMFTNSSIKFELDIEPKVFKPQSGADALN DSQDFPFPETPAKVWPQDEYIVEYSLEYGFLRLSQATRQRLSIPVMVVTLDPTRDQCFGD RFSRLLLDEFLGYDDILMSSVKGLAENEENKGFLRNVVSGEHYRFVSMWMARTSYLAAFV IMVIFTLSVSMLLRYSHHQIFVFIVDLLQMLEMNMAIAFPAAPLLTVILALVGMEAIMSE FFNDTTTAFYIILTVWLADQYDAICCHTNTSKRHWLRFFYLYHFAFYAYHYRFNGQYSSL ALVTSWLFIQHSMIYFFHHYELPAILQQIRIQEMLLQTPPLGPGTPTALPDDLNNNSGSP ATPDPSPPLALGPSSSPAPTGGASGPGSLGAGASVSGSDLGWVAETAAIISDASFLSGLS ASLLERRPTAPSTPDSSRPDPGVPLEDAPAPAGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem259 |
Synonyms | Tmem259; ORF61; Membralin; Transmembrane protein 259 |
UniProt ID | Q8CIV2 |
◆ Recombinant Proteins | ||
NUDT3-3144H | Recombinant Human NUDT3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PPP2R2C-13255M | Recombinant Mouse PPP2R2C Protein | +Inquiry |
Kcnj12-3757R | Recombinant Rat Kcnj12, His-tagged | +Inquiry |
AKR1C2-599R | Recombinant Rat AKR1C2 Protein | +Inquiry |
OLR1-5099H | Recombinant Human OLR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
TNNI1-49H | Native Human troponin I type 1 Protein | +Inquiry |
HDL-397H | Native Human High Density Lipoprotein, DiI labeled | +Inquiry |
Immunoglobulin G3-83H | Native Human Immunoglobulin G3 | +Inquiry |
Mucin-232P | Native Porcine Mucin | +Inquiry |
LDL-1538H | Native Human Low-density lipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Skin-116M | Mouse Skin Tissue Lysate (14 Days Old) | +Inquiry |
DHPS-6942HCL | Recombinant Human DHPS 293 Cell Lysate | +Inquiry |
SPI1-1683HCL | Recombinant Human SPI1 cell lysate | +Inquiry |
HYAL2-5323HCL | Recombinant Human HYAL2 293 Cell Lysate | +Inquiry |
PSMB3-2773HCL | Recombinant Human PSMB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem259 Products
Required fields are marked with *
My Review for All Tmem259 Products
Required fields are marked with *
0
Inquiry Basket