Recombinant Full Length Mouse Marvel Domain-Containing Protein 2(Marveld2) Protein, His-Tagged
Cat.No. : | RFL36027MF |
Product Overview : | Recombinant Full Length Mouse MARVEL domain-containing protein 2(Marveld2) Protein (Q3UZP0) (1-555aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-555) |
Form : | Lyophilized powder |
AA Sequence : | MSSSDARSRIRDRGYSEVPRDTSCPDGTIRTFQSLHSSELAVSADPLPPPPLPLQPPFGP SFYSSDTEEPAVAPDLKPVRRFVPDSWKNFFRGKKKDPEWDNPVSDIRYISDGVECSPPA SPARANHHPYKDPSRGSQGTFNSQHEADAMFAHDPYASLDRRTQTARTYSEKVEEYNLRY AYMKSWAGLLRILGVVELLLGAGVFACVTAYIHKDNEWYNLFGYTQPYGMGGLGSLGNTY GGYYYSGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGVNVALFIL YMAAAIVYVNDTNRGGLCYYPLFNTPMNAMFCRVEGGQIAAMIFLFVTMIVYLVSALVCL KLWRHEAARRHREFLEQQEINDPSLSSKRKMCEAAISDRQRDQEVNVKDLRTTTKMTPEL LSGHIPPGHIPKPIVMPDYVAKYPVIQTDDDRERYKAVFQDQFSEYKELSAEVQAILRKF DELDTVMSRLPHHSENRQEHERISRIHEEFRKKKNDPSFLEKKERCDYLKNKLSHIKQRI QEYDKVMNWDTQGYP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Marveld2 |
Synonyms | Marveld2; Mrvldc2; Tric; MARVEL domain-containing protein 2; Tricellulin |
UniProt ID | Q3UZP0 |
◆ Recombinant Proteins | ||
Cfb-2107M | Recombinant Mouse Cfb protein, His-tagged | +Inquiry |
RFL27488SF | Recombinant Full Length Sminthopsis Douglasi Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged | +Inquiry |
DPPA5-12152H | Recombinant Human DPPA5, GST-tagged | +Inquiry |
CYP11A1-1152C | Recombinant Chicken CYP11A1 | +Inquiry |
GOLPH3L-3591Z | Recombinant Zebrafish GOLPH3L | +Inquiry |
◆ Native Proteins | ||
IgG-341D | Native Dog IgG | +Inquiry |
Lectin-1846S | Active Native Soybean Agglutinin Protein, Biotinylated | +Inquiry |
MPOB-234H | Native Human Myeloperoxidase Isoform B | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
FABP3-42H | Native Human FABP3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAFG-4559HCL | Recombinant Human MAFG 293 Cell Lysate | +Inquiry |
BCAM-1649HCL | Recombinant Human BCAM cell lysate | +Inquiry |
SLC3A2-2015HCL | Recombinant Human SLC3A2 cell lysate | +Inquiry |
HepG2-043HCL | Human HepG2 Nuclear Cell Lysate | +Inquiry |
COMMD5-7369HCL | Recombinant Human COMMD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Marveld2 Products
Required fields are marked with *
My Review for All Marveld2 Products
Required fields are marked with *
0
Inquiry Basket