Recombinant Full Length Mouse Lipid Phosphate Phosphatase-Related Protein Type 5(Lppr5) Protein, His-Tagged
Cat.No. : | RFL28995MF |
Product Overview : | Recombinant Full Length Mouse Lipid phosphate phosphatase-related protein type 5(Lppr5) Protein (Q8BJ52) (1-321aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-321) |
Form : | Lyophilized powder |
AA Sequence : | MPLLPVALISSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDS SAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTV RFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGN PDLIMRARKTFPSKEAALSVYAATYLTMYITSTIKAKGTRLAKPVLCLGLMCLAFLTGLN RVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQPENGHIHRDNVARMPMTNIPRV ESPLEKVTSLQNHVTAFAEVT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Plppr5 |
Synonyms | Plppr5; Lppr5; Phospholipid phosphatase-related protein type 5; Lipid phosphate phosphatase-related protein type 5; Plasticity-related gene 5 protein; PRG-5 |
UniProt ID | Q8BJ52 |
◆ Native Proteins | ||
IgE-18H | Native Human Immunoglobulin E, lambda | +Inquiry |
TF-8271H | Native Human Serum Transferrin APO (Iron Free) | +Inquiry |
IgA-250M | Native Monkey Immunoglobulin A | +Inquiry |
C3-147C | Active Native Botulinum C3 Enzyme | +Inquiry |
Lectin-1851U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 594 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HCAR3-737HCL | Recombinant Human HCAR3 cell lysate | +Inquiry |
CEP104-906HCL | Recombinant Human CEP104 cell lysate | +Inquiry |
NLRC4-3805HCL | Recombinant Human NLRC4 293 Cell Lysate | +Inquiry |
IFT57-5273HCL | Recombinant Human IFT57 293 Cell Lysate | +Inquiry |
C12orf29-8324HCL | Recombinant Human C12orf29 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Plppr5 Products
Required fields are marked with *
My Review for All Plppr5 Products
Required fields are marked with *
0
Inquiry Basket