Recombinant Full Length Mouse Leucine-Rich Repeat-Containing Protein 4C(Lrrc4C) Protein, His-Tagged
Cat.No. : | RFL14862MF |
Product Overview : | Recombinant Full Length Mouse Leucine-rich repeat-containing protein 4C(Lrrc4c) Protein (Q8C031) (45-640aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (45-640) |
Form : | Lyophilized powder |
AA Sequence : | QTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEI LQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIP SYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDEL DLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPH DLFTPLHHLERIHLHHNPWNCNCDILWLSWWIRDMAPSNTACCARCNTPPNLKGRYIGEL DQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIA VLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEP SQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMK TTKIIIGCFVAITLMAAVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESH LPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lrrc4c |
Synonyms | Lrrc4c; Ngl1; Leucine-rich repeat-containing protein 4C; Netrin-G1 ligand; NGL-1 |
UniProt ID | Q8C031 |
◆ Native Proteins | ||
Lectin-1828P | Active Native Pisum Sativum Agglutinin Protein, Biotinylated | +Inquiry |
Neuraminidase-011C | Active Native Clostridium perfringens Choloylglycine Hydrolase | +Inquiry |
UMOD-91P | Native Porcine UMOD | +Inquiry |
MYH-10B | Active Native Bovine Myosin Protein | +Inquiry |
Heart-005H | Human Heart Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSSC4-695HCL | Recombinant Human TSSC4 293 Cell Lysate | +Inquiry |
POU4F3-3001HCL | Recombinant Human POU4F3 293 Cell Lysate | +Inquiry |
THAP5-1105HCL | Recombinant Human THAP5 293 Cell Lysate | +Inquiry |
LRRC17-4647HCL | Recombinant Human LRRC17 293 Cell Lysate | +Inquiry |
GLE1-5906HCL | Recombinant Human GLE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lrrc4c Products
Required fields are marked with *
My Review for All Lrrc4c Products
Required fields are marked with *
0
Inquiry Basket