Recombinant Full Length Human Leucine-Rich Repeat-Containing Protein 4C(Lrrc4C) Protein, His-Tagged
Cat.No. : | RFL15679HF |
Product Overview : | Recombinant Full Length Human Leucine-rich repeat-containing protein 4C(LRRC4C) Protein (Q9HCJ2) (45-640aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (45-640) |
Form : | Lyophilized powder |
AA Sequence : | QTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEI LQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIP SYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDEL DLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPH DLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGEL DQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIA VLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEP SQDEARTTDNNVGPTPVVDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMK TTKIIIGCFVAITLMAAVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESH LPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LRRC4C |
Synonyms | LRRC4C; KIAA1580; NGL1; UNQ292/PRO331; Leucine-rich repeat-containing protein 4C; Netrin-G1 ligand; NGL-1 |
UniProt ID | Q9HCJ2 |
◆ Recombinant Proteins | ||
RFL18131BF | Recombinant Full Length Buchnera Aphidicola Subsp. Schizaphis Graminum Preprotein Translocase Subunit Sece(Sece) Protein, His-Tagged | +Inquiry |
Amelx-3407R | Recombinant Rat Amelx, His-tagged | +Inquiry |
DUSP26-2324H | Recombinant Human DUSP26 protein, His-tagged | +Inquiry |
BHMT2-982R | Recombinant Rat BHMT2 Protein | +Inquiry |
ERP27-2859M | Recombinant Mouse ERP27 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TcdB-189C | Active Native Clostridium difficile Toxin B Protein | +Inquiry |
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
ALB-38R | Native Rhesus monkey Albumin (ALB) Protein | +Inquiry |
C5a-12H | Active Native Human C5a Anaphylatoxin Protein | +Inquiry |
LTF-4771H | Native Human Lactotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP11-6783HCL | Recombinant Human DUSP11 293 Cell Lysate | +Inquiry |
HIC2-786HCL | Recombinant Human HIC2 cell lysate | +Inquiry |
BLNK-1858HCL | Recombinant Human BLNK cell lysate | +Inquiry |
Skin-849P | Pig Skin Membrane Lysate, Total Protein | +Inquiry |
EFCAB11-8286HCL | Recombinant Human C14orf143 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRRC4C Products
Required fields are marked with *
My Review for All LRRC4C Products
Required fields are marked with *
0
Inquiry Basket