Recombinant Full Length Mouse Interferon Alpha-Inducible Protein 27-Like Protein 2A(Ifi27L2A) Protein, His-Tagged
Cat.No. : | RFL23430MF |
Product Overview : | Recombinant Full Length Mouse Interferon alpha-inducible protein 27-like protein 2A(Ifi27l2a) Protein (Q8R412) (25-90aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-90) |
Form : | Lyophilized powder |
AA Sequence : | AMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGA AVGALL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ifi27l2a |
Synonyms | Ifi27l2a; Ifi27; Isg12; Interferon alpha-inducible protein 27-like protein 2A; Interferon-stimulated gene 12 protein; ISG12 |
UniProt ID | Q8R412 |
◆ Native Proteins | ||
CGA-8163H | Native Human Chorionic Gonadotropin | +Inquiry |
FGA-80H | Active Native Human Fibrinogen (plasminogen depleted) | +Inquiry |
Complement C1r-45H | Native Human Complement C1r | +Inquiry |
IgA-238R | Native Rabbit Immunoglobulin A | +Inquiry |
C7-102H | Active Native Human C7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Appendix-4H | Human Appendix Tissue Lysate | +Inquiry |
Liver-289C | Cynomolgus monkey Liver Lysate | +Inquiry |
RNF10-2311HCL | Recombinant Human RNF10 293 Cell Lysate | +Inquiry |
TMEM174-987HCL | Recombinant Human TMEM174 293 Cell Lysate | +Inquiry |
IL17F-2045HCL | Recombinant Human IL17F cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ifi27l2a Products
Required fields are marked with *
My Review for All Ifi27l2a Products
Required fields are marked with *
0
Inquiry Basket