Recombinant Full Length Mouse Glipr1-Like Protein 2(Glipr1L2) Protein, His-Tagged
Cat.No. : | RFL6195MF |
Product Overview : | Recombinant Full Length Mouse GLIPR1-like protein 2(Glipr1l2) Protein (Q9CQ35) (1-332aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-332) |
Form : | Lyophilized powder |
AA Sequence : | MKASLPWSVVWRAQSNYVRLRRVLKLCELWLLLVGSGLNAKLPLEEDVDFINEYVGLHNE LRGTVFPPGVNLRFMTWDVALSRTARAWGKKCMYSRNTHLDKLHESHPVFTEIGENMWVG PVEDFTVTTAIRSWHEERKSYSYLNDTCVEDQNCSHYIQLVWDSSYKVGCAVTSCARAGG FTHAALFICNYAPGGTLTRRPYQAGQFCSRCGPGDQCTDYLCSNTVRDEATYYQFWYPPW EKPRPVVCNPMCIFILFLRVASLLLCVIVVLIVQSRFPVILMETPTIISAEEEGKTEVEI VMEEGEGEGEGGEGEGEGEEKEEEEMLEEDEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Glipr1l2 |
Synonyms | Glipr1l2; GLIPR1-like protein 2 |
UniProt ID | Q9CQ35 |
◆ Recombinant Proteins | ||
RFL22807HF | Recombinant Full Length Human Glipr1-Like Protein 2(Glipr1L2) Protein, His-Tagged | +Inquiry |
GLIPR1L2-13300H | Recombinant Human GLIPR1L2, His-tagged | +Inquiry |
GLIPR1L2-6406M | Recombinant Mouse GLIPR1L2 Protein | +Inquiry |
GLIPR1L2-4961H | Recombinant Human GLIPR1L2 Protein, GST-tagged | +Inquiry |
GLIPR1L2-5331HF | Recombinant Full Length Human GLIPR1L2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLIPR1L2-5903HCL | Recombinant Human GLIPR1L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Glipr1l2 Products
Required fields are marked with *
My Review for All Glipr1l2 Products
Required fields are marked with *
0
Inquiry Basket