Recombinant Human GLIPR1L2 Protein, GST-tagged

• Cat.No.: GLIPR1L2-4961H
• Product Overview: Human GLIPR1L2 full-length ORF ( NP_689649.1, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the cysteine-rich secretory protein, antigen 5, and pathogenesis-related 1 superfamily. Members of this family have roles in a variety of processes, including cancer and immune defense. This gene is located in a cluster with two related genes on chromosome 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]
• Molecular Mass: 55.4 kDa
• AA Sequence: MEAARPFAREWRAQSLPLAVGGVLKLRLCELWLLLLGSSLNARFLPDEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTASIAIRSWHAEKKMYNFENGSCSGDCSNYIQLVWDHSYKVGCAVTPCSKIGHIIHAAIFICNYAPGGTLTRRPYEPGIFCTRCGRRDKCTDFLCSKIKKINMKKMHNGLDKKNKRLNTSFLWSC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GLIPR1L2 GLI pathogenesis-related 1 like 2 [ Homo sapiens ]
• Official Symbol: GLIPR1L2
• Synonyms: GLIPR1L2; GLI pathogenesis-related 1 like 2; GLIPR1-like protein 2; MGC39497
• Gene ID: 144321
• mRNA Refseq: NM_152436
• Protein Refseq: NP_689649
• MIM: 610394
• UniProt ID: Q4G1C9