Recombinant Full Length Mouse Fatty Acid Desaturase 2-Like Protein Fads2P1(Fads2P1) Protein, His-Tagged
Cat.No. : | RFL19608MF |
Product Overview : | Recombinant Full Length Mouse Fatty acid desaturase 2-like protein FADS2P1(Fads2p1) Protein (Q0VAX3) (1-487aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-487) |
Form : | Lyophilized powder |
AA Sequence : | MKLEEKLEHNESLVGKSRPCLHDTHQANGKPIANGNPTANGKVEVYEKQEANGKGNRLGK CLNLYTWQEIQRHSQEADQWLVIDRKVYNVTDWAGKHPGGRRVLNHYAGQDATDAFRAMH LDLGMVKLYLKPLLIGELSPEEPSQEKNKNAQLVEDFRELRKTLEAMNMFSANLRFFFLH LAQILILEISAWLILHHFGSSWLVTILISFLLTVSQAQCSFLQHDLGHLSMFKKSKWNHL MHKFVMCHLKGLSADWWNYRHFQHHVKPNIYPKDPDIDVGPLFLVGDTQPIKYGKKKIKY IDYEKQHLYFYMVALPFLMPVYFNLQSMQVMYLRKYWMDIAWVSSFYIRYFITFGPFYGI FGTVLLIYLVKFIESPWIAYVTQMSHIPMKMSSEENHDWLSTQVVATCNIEQSFFNDWFT GHLNFQIEHHLFPTMPRHNYHKVAPLVKSLCAKHGLQYINKPILKAFGDIVRSLKKSASL WMNAYYE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Fads2p1 |
Synonyms | Fads2b; Fatty acid desaturase 2-like protein FADS2B; Fatty acid desaturase 2B, pseudogene |
UniProt ID | Q0VAX3 |
◆ Recombinant Proteins | ||
NUPL2-2668C | Recombinant Chicken NUPL2 | +Inquiry |
IGFN1-2581HF | Recombinant Full Length Human IGFN1 Protein, GST-tagged | +Inquiry |
NRG1-16H | Recombinant Human NRG1 protein | +Inquiry |
PPARGC1A-13163M | Recombinant Mouse PPARGC1A Protein | +Inquiry |
PYM1-3172H | Recombinant Human PYM1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CP-26450TH | Native Human CP | +Inquiry |
SHBG-30637TH | Native Human SHBG protein | +Inquiry |
Liver-021H | Human Liver Lysate, Total Protein | +Inquiry |
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
LDH3-21H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QTNF7-232HCL | Recombinant Human C1QTNF7 cell lysate | +Inquiry |
CD33-1808MCL | Recombinant Mouse CD33 cell lysate | +Inquiry |
GAS8-6015HCL | Recombinant Human GAS8 293 Cell Lysate | +Inquiry |
RGS3-2376HCL | Recombinant Human RGS3 293 Cell Lysate | +Inquiry |
Adrenal-421S | Sheep Adrenal Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fads2p1 Products
Required fields are marked with *
My Review for All Fads2p1 Products
Required fields are marked with *
0
Inquiry Basket