Recombinant Full Length Mouse Estradiol 17-Beta-Dehydrogenase 12(Hsd17B12) Protein, His-Tagged
Cat.No. : | RFL21344MF |
Product Overview : | Recombinant Full Length Mouse Estradiol 17-beta-dehydrogenase 12(Hsd17b12) Protein (O70503) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MECAPPAAGFLYWVGASTIAYLALRASYSLFRAFQVWCVGNEALVGPRLGEWAVVTGGTD GIGKAYAEELAKRGMKIVLISRSQDKLNQVSNNIKEKFNVETRTIAVDFSLDDIYDKIKT GLSGLEIGVLVNNVGMSYEYPEYFLEIPDLDNTIKKLININVLSVCKVTRLVLPGMVERS KGVILNISSASGMLPVPLLTIYSATKAFVDFFSQCLHEEYKSKGIFVQSVMPYLVATKLA KIQKPTLDKPSAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKS LRNRYLKKRKKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Hsd17b12 |
Synonyms | Hsd17b12; Kik1; Very-long-chain 3-oxoacyl-CoA reductase; 17-beta-hydroxysteroid dehydrogenase 12; 17-beta-HSD 12; 3-ketoacyl-CoA reductase; KAR; Estradiol 17-beta-dehydrogenase 12; KIK-I |
UniProt ID | O70503 |
◆ Recombinant Proteins | ||
RFL21344MF | Recombinant Full Length Mouse Estradiol 17-Beta-Dehydrogenase 12(Hsd17B12) Protein, His-Tagged | +Inquiry |
RFL19200AF | Recombinant Full Length Anas Platyrhynchos Estradiol 17-Beta-Dehydrogenase 12(Hsd17B12) Protein, His-Tagged | +Inquiry |
Hsd17b12-3441M | Recombinant Mouse Hsd17b12 Protein, Myc/DDK-tagged | +Inquiry |
HSD17B12-46H | Recombinant Human HSD17B12, GST-tagged | +Inquiry |
HSD17B12-2821H | Recombinant Human HSD17B12 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B12-818HCL | Recombinant Human HSD17B12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Hsd17b12 Products
Required fields are marked with *
My Review for All Hsd17b12 Products
Required fields are marked with *
0
Inquiry Basket