Recombinant Full Length Mouse Epithelial Membrane Protein 2(Emp2) Protein, His-Tagged
Cat.No. : | RFL36424MF |
Product Overview : | Recombinant Full Length Mouse Epithelial membrane protein 2(Emp2) Protein (O88662) (1-172aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-172) |
Form : | Lyophilized powder |
AA Sequence : | MLVILAFIIVFHIVSTALLFISTIDNAWWVGDSFSADLWRVCTNSTNCTEINELTGPEAF EGYSVMQAVQATMILSTILSCISFLIFLLQLFRLKQGERFVLTSIIQLMSCLCVMIGASI YTDRRQDLHQQNRKLYYLLQEGSYGYSFILAWVAFAFTFISGLMYMILRKRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Emp2 |
Synonyms | Emp2; Xmp; Epithelial membrane protein 2; EMP-2; Protein XMP |
UniProt ID | O88662 |
◆ Recombinant Proteins | ||
Emp2-2816M | Recombinant Mouse Emp2 Protein, Myc/DDK-tagged | +Inquiry |
EMP2-1228Z | Recombinant Zebrafish EMP2 | +Inquiry |
EMP2-4250HF | Recombinant Full Length Human EMP2 Protein, GST-tagged | +Inquiry |
EMP2-1466R | Recombinant Rhesus monkey EMP2 Protein, His-tagged | +Inquiry |
EMP2-2095R | Recombinant Rat EMP2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMP2-6606HCL | Recombinant Human EMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Emp2 Products
Required fields are marked with *
My Review for All Emp2 Products
Required fields are marked with *
0
Inquiry Basket