Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase Synoviolin(Syvn1) Protein, His-Tagged
Cat.No. : | RFL32310MF |
Product Overview : | Recombinant Full Length Mouse E3 ubiquitin-protein ligase synoviolin(Syvn1) Protein (Q9DBY1) (23-612aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-612) |
Form : | Lyophilized powder |
AA Sequence : | YYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKVMGKVFFGQLRAAEMEHLLERSW YAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWLFHCRIV SLMFLLGILDFLFVSHAYHSILTRGASVQLVFGFEYAILMTMVLTIFIKYVLHSVDLQSE NPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTFPLFAIRPMYLAMRQFKKAVTDA IMSRRAIRNMNTLYPDATPEELQAVDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQR QQTCPTCRMDVLRASLPAQSPPPPEPADQGPPPAPHPQPLLPQPPNFPQGLLPPFPPGMF PLWPPMGPFPPVPPPPSSGEAAAPPPTSTAVSRPSGAATTTAAGTSTSAPAPGSVPGPEA GPAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLR NIHTLLDAAMLQINQYLTVLASLGPPRPATSVNPTEETASTVVSAAPSTSAPSSEAPTPS PGASPPIPEAEKPPAPESVGIVEELPEDGEPDAAELRRRRLQKLESPVAH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Syvn1 |
Synonyms | Syvn1; Hrd1; Kiaa1810; E3 ubiquitin-protein ligase synoviolin; RING-type E3 ubiquitin transferase synoviolin; Synovial apoptosis inhibitor 1 |
UniProt ID | Q9DBY1 |
◆ Recombinant Proteins | ||
RFL18989HF | Recombinant Full Length Human E3 Ubiquitin-Protein Ligase Synoviolin(Syvn1) Protein, His-Tagged | +Inquiry |
SYVN1-8935M | Recombinant Mouse SYVN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL32310MF | Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase Synoviolin(Syvn1) Protein, His-Tagged | +Inquiry |
SYVN1-12007Z | Recombinant Zebrafish SYVN1 | +Inquiry |
SYVN1-4592R | Recombinant Rhesus monkey SYVN1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYVN1-1295HCL | Recombinant Human SYVN1 293 Cell Lysate | +Inquiry |
SYVN1-1296HCL | Recombinant Human SYVN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Syvn1 Products
Required fields are marked with *
My Review for All Syvn1 Products
Required fields are marked with *
0
Inquiry Basket