Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase March9(41342) Protein, His-Tagged
Cat.No. : | RFL23180MF |
Product Overview : | Recombinant Full Length Mouse E3 ubiquitin-protein ligase MARCH9(41342) Protein (Q3TZ87) (1-348aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-348) |
Form : | Lyophilized powder |
AA Sequence : | MLKSRLRMFLNELKLLVLTGGGRPRAEPQPRGGGGGGCGWAPFAGCSARDGDGDEEEYYG SEPRARGLAGDKEPRAGPPPPPAPPPPPPGALDALSLSSSLDSGLRTPQCRICFQGPEQG ELLSPCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVI EKVQIAAIVLGSLFLVASISWLIWSSLSPSAKWQRQDLLFQICYGMYGFMDVVCIGLIVH EGSSVYRIFKRWQAVNQQWKVLNYDKTKDVGGDTGGGAAGKPGPRTSRTSPPAGAPTRPP AAQRMRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | March9 |
Synonyms | Marchf9; March9; E3 ubiquitin-protein ligase MARCHF9; Membrane-associated RING finger protein 9; Membrane-associated RING-CH protein IX; MARCH-IX; RING-type E3 ubiquitin transferase MARCHF9 |
UniProt ID | Q3TZ87 |
◆ Recombinant Proteins | ||
MARCH9-2502R | Recombinant Rhesus Macaque MARCH9 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADHFE1-9422H | Recombinant Human ADHFE1 protein, His-tagged | +Inquiry |
MARCH9-5369M | Recombinant Mouse MARCH9 Protein, His (Fc)-Avi-tagged | +Inquiry |
MARCH9-2682R | Recombinant Rhesus monkey MARCH9 Protein, His-tagged | +Inquiry |
RFL18741HF | Recombinant Full Length Human E3 Ubiquitin-Protein Ligase March9(41342) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All March9 Products
Required fields are marked with *
My Review for All March9 Products
Required fields are marked with *
0
Inquiry Basket