Recombinant Full Length Mouse Cyclic Nucleotide-Gated Olfactory Channel(Cnga2) Protein, His-Tagged
Cat.No. : | RFL24855MF |
Product Overview : | Recombinant Full Length Mouse Cyclic nucleotide-gated olfactory channel(Cnga2) Protein (Q62398) (1-664aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-664) |
Form : | Lyophilized powder |
AA Sequence : | MMTEKSNGVKSSPANNHNHHPPPSIKANGKDDHRAGSRPQSVAADDDTSSELQRLAEMDT PRRGRGGFRRIVRLVGIIRDWANKNFREEEPRPDSFLERFRGPELQTVTTHQGDGKGDKD GEGKGTKKKFELFVLDPAGDWYYRWLFVIAMPVLYNWCLLVARACFSDLQRNYFVVWLVL DYFSDTVYIADLIIRLRTGFLEQGLLVKDPKKLRDNYIHTLQFKLDVASIIPTDLIYFAV GIHSPEVRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISK SIGFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFL IGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKDMEAKVIKWFDYLWT NKKTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQDCEAGLLVELVLKLRPQVFSPG DYICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTA NIRSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVAASMEVDVQ EKLEQLETNMETLYTRFARLLAEYTGAQQKLKQRITVLETKMKQNHEDDYLSDGINTPEP AVAE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cnga2 |
Synonyms | Cnga2; Cncg2; Cncg4; Cyclic nucleotide-gated olfactory channel; Cyclic nucleotide-gated cation channel 2; Cyclic nucleotide-gated channel alpha-2; CNG channel alpha-2; CNG-2; CNG2 |
UniProt ID | Q62398 |
◆ Recombinant Proteins | ||
ATP6V1E1-2164M | Recombinant Mouse ATP6V1E1 Protein | +Inquiry |
GPC2-33M | Active Recombinant Mouse GPC2 Protein, His-tagged | +Inquiry |
PHAX-729H | Recombinant Human PHAX | +Inquiry |
MTHFD1L-5703H | Recombinant Human MTHFD1L Protein, GST-tagged | +Inquiry |
GABRA5-7595H | Recombinant Human GABRA5 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Heparin-200S | Active Native Swine Heparin | +Inquiry |
MUC19-185B | Native Bovine Mucin Protein | +Inquiry |
Lectin-1778G | Active Native Galanthus Nivalis Lectin Protein, Fluorescein labeled | +Inquiry |
Fibrinogen-69C | Active Native Canine Fibrinogen | +Inquiry |
CA 19-9-135 | Active Native Human CA 19-9 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1orf218-8164HCL | Recombinant Human C1orf218 293 Cell Lysate | +Inquiry |
PTPRS-2670HCL | Recombinant Human PTPRS 293 Cell Lysate | +Inquiry |
ZDHHC15-195HCL | Recombinant Human ZDHHC15 293 Cell Lysate | +Inquiry |
GAB1-6076HCL | Recombinant Human GAB1 293 Cell Lysate | +Inquiry |
RAB1B-2622HCL | Recombinant Human RAB1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Cnga2 Products
Required fields are marked with *
My Review for All Cnga2 Products
Required fields are marked with *
0
Inquiry Basket