Recombinant Full Length Mouse Consortin(Cnst) Protein, His-Tagged
Cat.No. : | RFL10188MF |
Product Overview : | Recombinant Full Length Mouse Consortin(Cnst) Protein (Q8CBC4) (1-711aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-711) |
Form : | Lyophilized powder |
AA Sequence : | MDDSDPPTYSLQIEPQDGCHPGDSVERRVTRLPSVSDENENQLAGDGPAGLTTSEGAMGR ATVSEQDSLNNNESFPSSCEAAPTENAENTPSEGPKDDPPSLGQDQKLPAKRSPRAKKSS PKSAPPGDAVPVMQTQNATSQAAGEEEAAGVNANDPPKAPALQPLFSLIRGEVAQMDSRA LPLFLHQVAETYFQEEDYEKAMKFIQLERLYHEQLLANLSAIQEQWETKWKAVQPRTVTP LRNSEKGFNGEDFEQLAKICTTHQDPLLSKLKTAPVEPSPERKSLARAIMSEEAVGTEAA AKEPEIETCPSTDPSGDRHEEEPQESSPGCHQMEWQTASPELPGTAGKDHTEELPSSTNA TLDLHTQSLETAGSRSGPAAASNACKDSSCVPAPPTEDHCGVARDPKVAPPSESVAEQKL STGDDGALPGLISEGKYSQAHRKELCLPLQDAFEALPRDQPHSSEVAEPRQPDVTASDGK SAQSQAGLETGPESALCGDRKACDVSTLCLEVCMAPEERRDSEDRVSKETEDYLHSLLER CLKDAEDSLSYEDIQDDDSDLLQDLSPEEASYSLQEDLPPDESTLSLDDLAKKIEIAEAI PAEGLVSILKKRNDTVGSHPAQMQQKPAKRRVRFQEIDDNLEQDEVGGGSCILLILLCIA TVFLSVGGTALYCTLGNIESPVCTDFADNVDFYYTKLLQGVAGLKHWVYLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cnst |
Synonyms | Cnst; Consortin |
UniProt ID | Q8CBC4 |
◆ Recombinant Proteins | ||
GATSL3-2142R | Recombinant Rat GATSL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FCER1G-3713C | Recombinant Chicken FCER1G | +Inquiry |
RFL10596SF | Recombinant Full Length Saimiri Boliviensis Boliviensis Muscarinic Acetylcholine Receptor M5(Chrm5) Protein, His-Tagged | +Inquiry |
TJP1-464H | Recombinant Human TJP1 Protein, His-tagged | +Inquiry |
ITGA1-2767R | Recombinant Rat ITGA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HB-42P | Native Pig Hemoglobin (HB) Protein | +Inquiry |
IgG-009H | Native Hamster Whole Molecule IgG, Biotin Conjugate | +Inquiry |
HP-146R | Native Rabbit Hemoglobin | +Inquiry |
Lectin-1787G | Active Native Griffonia Simplicifolia Lectin II Protein, Agarose bound | +Inquiry |
Collagen Type I-03R | Native Rat Collagen Type I (Atelocollagen) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZBTB25-1952HCL | Recombinant Human ZBTB25 cell lysate | +Inquiry |
ACOX1-511HCL | Recombinant Human ACOX1 cell lysate | +Inquiry |
ADAT3-996HCL | Recombinant Human ADAT3 cell lysate | +Inquiry |
KCNK18-5037HCL | Recombinant Human KCNK18 293 Cell Lysate | +Inquiry |
ZNF460-68HCL | Recombinant Human ZNF460 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cnst Products
Required fields are marked with *
My Review for All Cnst Products
Required fields are marked with *
0
Inquiry Basket