Recombinant Full Length Mouse Cd82 Antigen(Cd82) Protein, His-Tagged
Cat.No. : | RFL2400MF |
Product Overview : | Recombinant Full Length Mouse CD82 antigen(Cd82) Protein (P40237) (1-266aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-266) |
Form : | Lyophilized powder |
AA Sequence : | MGAGCVKVTKYFLFLFNLLFFILGAVILGFGVWILADKNSFISVLQTSSSSLQVGAYVFI GVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNT VMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIK EEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENFGILLGVCAGVAVI ELLGLFLSICLCRYIHSEDYSKVPKY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cd82 |
Synonyms | Cd82; Kai1CD82 antigen; C33 antigen; IA4; Inducible membrane protein R2; Metastasis suppressor Kangai-1 homolog; CD antigen CD82 |
UniProt ID | P40237 |
◆ Recombinant Proteins | ||
RFL11281RF | Recombinant Full Length Rat Cd82 Antigen(Cd82) Protein, His-Tagged | +Inquiry |
CD82-1470M | Recombinant Mouse CD82 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD82-3970H | Recombinant Human CD82(Gly103-Gln225) Protein, N-Fc-tagged | +Inquiry |
CD82-0867H | Recombinant Human CD82 Protein, GST-Tagged | +Inquiry |
CD82-3721H | Recombinant Human CD82 Protein (Gly111-Leu228), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD82-1960HCL | Recombinant Human CD82 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd82 Products
Required fields are marked with *
My Review for All Cd82 Products
Required fields are marked with *
0
Inquiry Basket