Recombinant Full Length Mouse Cd70 Antigen(Cd70) Protein, His-Tagged
Cat.No. : | RFL17124MF |
Product Overview : | Recombinant Full Length Mouse CD70 antigen(Cd70) Protein (O55237) (1-195aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-195) |
Form : | Lyophilized powder |
AA Sequence : | MPEEGRPCPWVRWSGTAFQRQWPWLLLVVFITVFCCWFHCSGLLSKQQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cd70 |
Synonyms | Cd70; Cd27l; Cd27lg; Tnfsf7; CD70 antigen; CD27 ligand; CD27-L; Tumor necrosis factor ligand superfamily member 7; CD antigen CD70 |
UniProt ID | O55237 |
◆ Recombinant Proteins | ||
RFL17124MF | Recombinant Full Length Mouse Cd70 Antigen(Cd70) Protein, His-Tagged | +Inquiry |
CD70-1806R | Recombinant Rhesus Monkey CD70 Protein, hIgG4-tagged | +Inquiry |
CD70-206H | Recombinant Human CD70 Protein, C-His-tagged | +Inquiry |
CD70-639AF488 | Recombinant Human CD70 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Cd70-972MAF647 | Recombinant Mouse Cd70 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD70-2710HCL | Recombinant Human CD70 cell lysate | +Inquiry |
CD70-1303RCL | Recombinant Rat CD70 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd70 Products
Required fields are marked with *
My Review for All Cd70 Products
Required fields are marked with *
0
Inquiry Basket