Recombinant Full Length Mouse Cardiolipin Synthase(Crls1) Protein, His-Tagged
Cat.No. : | RFL30586MF |
Product Overview : | Recombinant Full Length Mouse Cardiolipin synthase(Crls1) Protein (Q80ZM8) (1-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-303) |
Form : | Lyophilized powder |
AA Sequence : | MLAWRVARGAWGPLRVALRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRL PGAGPRTHCSGAGKAAPEPAAGGGGAAAQAPSARWVPASAASSYENPWTIPNLLSMTRIG LAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISI LYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPT FISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVI KGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Crls1 |
Synonyms | Crls1; Cardiolipin synthase; CMP-forming; CLS |
UniProt ID | Q80ZM8 |
◆ Native Proteins | ||
FGA-6H | Native Human Fibrinogen Protein, Alexa Fluor 488 labeled | +Inquiry |
Lectin-1719P | Native Peanut Lectin, FITC conjugated | +Inquiry |
Annexin-V-011H | Native Human Annexin-V Protein, FITC conjugated | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
MMP2-46H | Native Human MMP-2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Skin-774C | Chicken Skin Membrane Lysate, Total Protein | +Inquiry |
Spleen-62H | Human Spleen Tumor Tissue Lysate | +Inquiry |
KRT32-961HCL | Recombinant Human KRT32 cell lysate | +Inquiry |
RUNX2-2108HCL | Recombinant Human RUNX2 293 Cell Lysate | +Inquiry |
RBM4-531HCL | Recombinant Human RBM4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Crls1 Products
Required fields are marked with *
My Review for All Crls1 Products
Required fields are marked with *
0
Inquiry Basket