Recombinant Full Length Mouse Basigin(Bsg) Protein, His-Tagged
Cat.No. : | RFL8869MF |
Product Overview : | Recombinant Full Length Mouse Basigin(Bsg) Protein (P18572) (22-389aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-389) |
Form : | Lyophilized powder |
AA Sequence : | AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLDEDDPGAAPLKGSGTHMNDKDKNVRQRNAT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Bsg |
Synonyms | Bsg; Basigin; Basic immunoglobulin superfamily; HT7 antigen; Membrane glycoprotein gp42; CD antigen CD147 |
UniProt ID | P18572 |
◆ Recombinant Proteins | ||
BSG-1412M | Recombinant Mouse BSG protein, His-Avi-tagged, Biotinylated | +Inquiry |
RFL8869MF | Recombinant Full Length Mouse Basigin(Bsg) Protein, His-Tagged | +Inquiry |
BSG-1576R | Recombinant Rhesus Monkey BSG Protein | +Inquiry |
BSG-609H | Recombinant Human BSG Protein, His-tagged | +Inquiry |
BSG-613H | Recombinant Human BSG protein, mFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSG-2512MCL | Recombinant Mouse BSG cell lysate | +Inquiry |
BSG-2726HCL | Recombinant Human BSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Bsg Products
Required fields are marked with *
My Review for All Bsg Products
Required fields are marked with *
0
Inquiry Basket