Recombinant Full Length Mouse Atp-Sensitive Inward Rectifier Potassium Channel 14(Kcnj14) Protein, His-Tagged
Cat.No. : | RFL29364MF |
Product Overview : | Recombinant Full Length Mouse ATP-sensitive inward rectifier potassium channel 14(Kcnj14) Protein (Q8JZN3) (1-434aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli expression system |
Species : | Mus musculus (Mouse) |
Tag : | His |
Form : | Lyophilized powder |
Protein length : | Full Length (1-434) |
AA Sequence : | MGLARALRRLSGALEPGNSRAGDEEEAGAGLCRNGWAPGPVAGSRRRGRFVKKDGHCNVR FVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLTFWLIASLHGDLAAPP PPAPCFSQVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVG AVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVT PEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELVVI LEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPVCS AKELDERAEQASHSPKSSFPGSLTAFCYENELALSCCQEEDEEEDTKEGTSAETPERAAS PQALTPTLALTLPP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcnj14 |
Synonyms | Kcnj14; Irk4; ATP-sensitive inward rectifier potassium channel 14; Inward rectifier K(+ channel Kir2.4; IRK-4; Potassium channel, inwardly rectifying subfamily J member 14 |
UniProt ID | Q8JZN3 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Kcnj14 Products
Required fields are marked with *
My Review for All Kcnj14 Products
Required fields are marked with *
0
Inquiry Basket