Recombinant Full Length Mouse 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5-->4-Isomerase Type 1(Hsd3B1) Protein, His-Tagged

• Cat.No.: RFL4903MF
• Product Overview: Recombinant Full Length Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1(Hsd3b1) Protein (P24815) (2-373aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mus musculus
• Source: E.coli
• Tag: His
• ProteinLength: Full Length of Mature Protein (2-373)
• Form: Lyophilized powder
• AA Sequence: AGWSCLVTGAGGFVGQRIIKMLVQEKELQEVRALDKVFRPETKEEFSKLQTKTKVTVLEG DILDAQCLRRACQGISVVIHTAAVIDVTGVIPRQTILDVNLKGTQNLLEACVQASVPAFI FCSSVDVAGPNSYKKIVLNGHEEQNHESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLN TCALRPMYIYGERSPFIFNAIIRALKNKGILCVTGKFSIANPVYVENVAWAHILAARGLR DPKKSTSIQGQFYYISDDTPHQSYDDLNYTLSKEWGLRPNASWSLPLPLLYWLAFLLETV SFLLRPVYRYRPLFNRHLITLSNSTFTFSYKKAQRDLGYEPLVNWEEAKQKTSEWIGTIV EQHREILDTKCQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Applications: SDS-PAGE
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Hsd3b1
• Synonyms: Hsd3b1; Hsd3b; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I; 3-beta-HSD I; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-be
• UniProt ID: P24815