Recombinant Full Length Micronemal Protein 6(Mic6) Protein, His-Tagged
Cat.No. : | RFL19009TF |
Product Overview : | Recombinant Full Length Micronemal protein 6(MIC6) Protein (Q9XYH7) (24-349aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | T.gondii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (24-349) |
Form : | Lyophilized powder |
AA Sequence : | SPFFAFLPGNGEIADNCSGNPCGGTAAGTCINTPSGYDCRCEPGYVLGVENDQVTCMMPS GVPMANFVQLSETPAACSSNPCGPEAAGTCKETNSGYICRCNQGYRISLDGTGNVTCIVR QESGCEENGCGPPDAVQSCRRLTGTAGRLCVCKENFIATIDASAHITCKRVPPHYRKPPF EFGKGGHPVDSEPSKRQREDEGESREPESDSTEPGRDQERRTPLEESQEPEGSTPDSQQS RGGSGSDSTESEEQGKEREEGSGHAGAIAGGVIGGLLLLSAAGAGVAYMRKSGSGGGEEI EYERGIEAAEASEVEVLVDLDSKTWD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC6 |
Synonyms | MIC6; Micronemal protein 6 |
UniProt ID | Q9XYH7 |
◆ Recombinant Proteins | ||
CRMP1-1811H | Recombinant Human CRMP1 Protein (Met1-Val250), His tagged | +Inquiry |
CD24-1632R | Recombinant Rhesus Monkey CD24 Protein, hIgG1-tagged | +Inquiry |
RFL14550AF | Recombinant Full Length Arabidopsis Thaliana Peroxisomal Membrane Protein Pex14(Pex14) Protein, His-Tagged | +Inquiry |
TXNDC5-4710H | Recombinant Human TXNDC5 protein | +Inquiry |
PTPN6-2576H | Recombinant Human PTPN6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
CVF-01I | Native purified cobra venom factor | +Inquiry |
FLNC-4360C | Native Chicken Filamin C, Gamma | +Inquiry |
Thromboplastin-078R | Native Rabbit Thromboplastin Protein | +Inquiry |
VLDL-395H | Native Human Very Low Density Lipoprotein, DiI labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CES1-7565HCL | Recombinant Human CES1 293 Cell Lysate | +Inquiry |
USP44-454HCL | Recombinant Human USP44 293 Cell Lysate | +Inquiry |
ZNF32-2009HCL | Recombinant Human ZNF32 cell lysate | +Inquiry |
HA-002H7N9CL | Recombinant H7N9 HA cell lysate | +Inquiry |
PLAT-2833HCL | Recombinant Human PLAT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC6 Products
Required fields are marked with *
My Review for All MIC6 Products
Required fields are marked with *
0
Inquiry Basket