Recombinant Full Length Methylococcus Capsulatus Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL9402MF |
Product Overview : | Recombinant Full Length Methylococcus capsulatus ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (Q60AK1) (1-637aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methylococcus capsulatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-637) |
Form : | Lyophilized powder |
AA Sequence : | MAKHSQHSSPPRKLFDTLNDLWQRAKSEAGLSAEGPEGTRRRNNLILYLLLVLSTLYLLN GYQTLRNEEIPYSEFLKAVAEGRVEQAVVTEQTISGTLKPEAEGESTRPFITVPLWNHEL AAELEKKGVKYTVRYGSNWFSSLIFNWIVPIVLLTLFWTWMARRMTGGRGFLSIGKKTRI QADTAAKVTFGDVAGADEAKQELRETIEFLQNPTRIQSLGGRMPKGVLLVGPPGTGKTLL ARAVAGEAGVPFFNISGSEFIELFVGVGAARVRDLFEQARQNAPCIIFIDELDAIGRSRG GPVVMGGHDEREQTLNQLLTEMDGFDPSVGVAVMAATNRPEILDKALLRSGRFDRQIVVD KPGLEDRVSILKLHTRKMKLAADVDLRVVAQRTPGFVGADLANAANEAAIIAVRANKAAI GMADFEAAIDRILAGPEKKSRLLNDAEKHRVAVHESGHALVAEIVPTGQPVHKVSIIPRG AAALGFTLQLPVEEKFLSTEQELKDQIAILLGGRTAEELVFGESSSGAQNDLEKASEIAR TMVCSLGMSKVLGPLTYGRRQQLAYLSVEGAEERNFSEETARLIDNEVRKLIEEGLQRVR EILTHHRVTLDRLAALLREKEVVSGEDVKAVIREAAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; MCA0851; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | Q60AK1 |
◆ Recombinant Proteins | ||
Wdr43-6981M | Recombinant Mouse Wdr43 Protein, Myc/DDK-tagged | +Inquiry |
PTPN9-4496R | Recombinant Rat PTPN9 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD4-103H | Recombinant Human CD4 Molecule(26-226aa) | +Inquiry |
CUGBP2-11700H | Recombinant Human CUGBP2, GST-tagged | +Inquiry |
CKB-1418R | Recombinant Rat CKB Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1833R | Active Native Ricinus Communis Agglutinin I Protein | +Inquiry |
RPE-426 | Native RPE | +Inquiry |
Complement C3b-47H | Native Human Complement C3b | +Inquiry |
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
LukAB-733S | Native S. aureus LukA-LukB heterodimer Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFR3-001CCL | Recombinant Cynomolgus FGFR3 cell lysate | +Inquiry |
KIRREL2-936HCL | Recombinant Human KIRREL2 cell lysate | +Inquiry |
PTPRC-1141MCL | Recombinant Mouse PTPRC cell lysate | +Inquiry |
EIF4H-6643HCL | Recombinant Human EIF4H 293 Cell Lysate | +Inquiry |
C8orf22-7954HCL | Recombinant Human C8orf22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket