Recombinant Full Length Campylobacter Jejuni Subsp. Jejuni Serotype O:2 Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL28534CF |
Product Overview : | Recombinant Full Length Campylobacter jejuni subsp. jejuni serotype O:2 Membrane protein insertase YidC(yidC) Protein (Q9PNX7) (1-528aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Campylobacter jejuni subsp. jejuni serotype O:2 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-528) |
Form : | Lyophilized powder |
AA Sequence : | MNNSNNIFQQKRILLAVVISFLFFVIYDYFFIPKQPLKIEQNITQKNQQNTSINNTPNIQ NATTNTPSAALVSQDSVISKVQSKHFEAQIDSFGRISAFYLKDRKYQNEKGEFINLVSKE NSPYPLEMRFSDPSINSEAFKIPYVANASNLFVDENGSQVLKLTQNLSGLKIEKDITFYP KGNYEIEVKLSKNANYFISPGYRPNIAVDSYTVHGALVMDNKETIETYKDGDVEKDESAN NVVMTSAFDRYYATFFYNFDKPLNVAISKDANQNPIVFAYSDNEFKAGGYIGSKEHVILR SIDPRLEAVVEYGWFTFIAKPMFEFLNFLHQYIGNWGWAIVVMTLIVRIILFPLTYKSMI SMNKLKDLAPKMKDIRERYKGDPQKMNMHMMELYKKHGANPMSGCLPILLQIPIFFAIYR VLLNAIELKAAPWAFWIHDLSVMDPYFILPILMGATMFLQQLITPMTIQDPMQAKIMKFL PVIFTFFFITFPAGLTLYWFVNNLCSLVQQWVINKIFAKEHHKKTSGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; Cj0958c; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q9PNX7 |
◆ Recombinant Proteins | ||
PAX6A-8893Z | Recombinant Zebrafish PAX6A | +Inquiry |
Gmps-3252M | Recombinant Mouse Gmps Protein, Myc/DDK-tagged | +Inquiry |
STOML1-8818M | Recombinant Mouse STOML1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL34098PF | Recombinant Full Length Prochlorococcus Marinus Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged | +Inquiry |
GPC1-3056H | Recombinant Human GPC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
SULF2-02F | Active Native Flavobacterium heparinum 2-O-Sulfatase | +Inquiry |
IgG-217H | Native Human Immunoglobulin G (IgG) | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLHL22-4910HCL | Recombinant Human KLHL22 293 Cell Lysate | +Inquiry |
P2RY8-1268HCL | Recombinant Human P2RY8 cell lysate | +Inquiry |
TBX6-656HCL | Recombinant Human TBX6 lysate | +Inquiry |
TNIK-1801HCL | Recombinant Human TNIK cell lysate | +Inquiry |
CER1-338HCL | Recombinant Human CER1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket