Recombinant Full Length Methanothermobacter Thermautotrophicus Archaeal Lon Protease (Mth_785) Protein, His-Tagged
Cat.No. : | RFL4929MF |
Product Overview : | Recombinant Full Length Methanothermobacter thermautotrophicus Archaeal Lon protease (MTH_785) Protein (O26878) (1-644aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanothermobacter thermautotrophicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-644) |
Form : | Lyophilized powder |
AA Sequence : | MKTTIKNSRTQESVSYEGNETKKGTGETLSYETSKDIEVPERLIDQIIGQEEAVETIKKA AEQRRNVLLIGEPGVGKSMLAKAMAELLPREQLQDILVYPNIEDPNNPLIGAVPAGEGRK IVMNHKNKARSQDEKKNLFMMLIISFILVLGFMMNQFLAAIIAAGIIFLALQQFRPRTTV MVPKLLVNNEGRQVAPFVDATGAHAGALLGDVRHDPYQSGGLGTPAHERVEAGMIHKANK GVLYIDEIGTMKMKTQQELLTAMQEKRYSITGQSETSSGAMVRSQAVPCDFVLVASGNLQ VLEGMHPALRSRIRGYGYEVFMKDTMPDTPENRDKLVQFVAQEVEKDGRIPHFSREAVEE IIREAQRRAGKKDSLTLKLRELGGLVRAAGDIAKSRGAELVETEDVIEAKKLSRTLEQQI ADRYIVQKKKYSVFKSEGGEVGRVNGLAIIGDRSGIILPIAAEAAPAQSKEEGRIIATGK LGEIAREAVQNVSALIKKYTGTDISNYDIHIQFLQAYDGVEGDSASVSVATAVISALEEI PVDQSVALTGSLSIRGDVLPVGGVTGKIEAAAEAGIRKVLIPASNMGDVMIEKKYEDMVE IVPVETLGDVLEHALIGKGKESLIQRMQKISDIVPSIMKKPAMH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTH_785 |
Synonyms | MTH_785; Archaeal Lon protease; ATP-dependent protease La homolog |
UniProt ID | O26878 |
◆ Recombinant Proteins | ||
TMEM55B-775C | Recombinant Cynomolgus Monkey TMEM55B Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB17-4796H | Recombinant Human RAB17 protein, GST-tagged | +Inquiry |
RFL25228EF | Recombinant Full Length Escherichia Coli O6:K15:H31 Upf0059 Membrane Protein Yebn(Yebn) Protein, His-Tagged | +Inquiry |
P2RY12-1103HFL | Recombinant Human P2RY12 protein, His&Flag-tagged | +Inquiry |
NAB2-2759R | Recombinant Rhesus Macaque NAB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TF-71R | Native Rat Apotransferrin | +Inquiry |
CA50-01H | Active Native Human Cancer Antigen 50 protein | +Inquiry |
CTSG-5327H | Native Human Cathepsin G | +Inquiry |
Ren -72R | Recombinant Rat Prorenin, His tag | +Inquiry |
HSP90-110H | Native Human HSP90 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX6-1586HCL | Recombinant Human SNX6 293 Cell Lysate | +Inquiry |
EPHB4-2128MCL | Recombinant Mouse EPHB4 cell lysate | +Inquiry |
SYTL4-1297HCL | Recombinant Human SYTL4 293 Cell Lysate | +Inquiry |
MACROD1-399HCL | Recombinant Human MACROD1 lysate | +Inquiry |
Ramos-01HL | Human Ramos lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MTH_785 Products
Required fields are marked with *
My Review for All MTH_785 Products
Required fields are marked with *
0
Inquiry Basket