Recombinant Full Length Methanol Utilization Control Sensor Protein Moxy(Moxy) Protein, His-Tagged
Cat.No. : | RFL1623PF |
Product Overview : | Recombinant Full Length Methanol utilization control sensor protein moxY(moxY) Protein (P29905) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Paracoccus denitrificans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MGLACAVSLSLCLIVSAILIVNARQAVQEETESAFRLAHEAVVRRLPPSHGGRDTMTEAI GLAEEIDGLRHVSARILDPEGQPLQHRAHGQLRSEASAPQWFSALMTPPLVEALVPITHY PNVLGMLRVAADPTDEIAEVWGDFSIILPVLFLAGLAMVGLAFLMTTLLTRRLQSVQAAM AQMQDGRLSVRAPDDRLTEFADLAAGVNALASHLQAEQAENDLLQARLIGSSEAERSRIA LDLHDEMGPQLFALRAAVSHAQAMTADLPERPAALDETLDAIAGHALEVQRSARTAINDL RPMLLGEASLAELLAELVTGFRDVASETRVVLDVDPEVEGSSPGELAELSIYRFARESVL NAMRHGRATVVRVSLDTMPDEPGQIVVRVTDNGKGPQSGTGRPTPGFGQIGIEDRARALG ATYLPPWRDNRLTHTELRMPRPCKLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | moxY |
Synonyms | moxY; Methanol utilization control sensor protein MoxY |
UniProt ID | P29905 |
◆ Recombinant Proteins | ||
OTUB1A-548Z | Recombinant Zebrafish OTUB1A | +Inquiry |
CEP68-1655Z | Recombinant Zebrafish CEP68 | +Inquiry |
TFF1-5687R | Recombinant Rat TFF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL7879CF | Recombinant Full Length Chelonia Mydas Atp Synthase Protein 8(Mt-Atp8) Protein, His-Tagged | +Inquiry |
RFL13862GF | Recombinant Full Length Chicken Ectonucleoside Triphosphate Diphosphohydrolase 8(Entpd8) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
LDLR-85H | Native Human Lipoprotein | +Inquiry |
Vtn-694M | Native Mouse Vitronectin | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
CNAN-133A | Native Arachis hypogaea seed Conarachin | +Inquiry |
IgM-208M | Native Monkey Immunoglobulin M | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGAT5-2067HCL | Recombinant Human MGAT5 cell lysate | +Inquiry |
NGLY1-3835HCL | Recombinant Human NGLY1 293 Cell Lysate | +Inquiry |
UBE2E3-580HCL | Recombinant Human UBE2E3 293 Cell Lysate | +Inquiry |
MAPK3-4494HCL | Recombinant Human MAPK3 293 Cell Lysate | +Inquiry |
CNIH2-7409HCL | Recombinant Human CNIH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All moxY Products
Required fields are marked with *
My Review for All moxY Products
Required fields are marked with *
0
Inquiry Basket