Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj1566(Mj1566) Protein, His-Tagged
Cat.No. : | RFL28800MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized protein MJ1566(MJ1566) Protein (Q58961) (1-447aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-447) |
Form : | Lyophilized powder |
AA Sequence : | MGFKYLKIKNPKVILTEWIPFGKNYMTEFIDRITLKEYQRKRIKYFTASERRDIRYKAVF ETSEYQTTVNIIEFIPETSVKFTAEIIGERKKDVFIYVDYLGRCIYSSEITKAGDEEEIV SLDNLSFVIPDLILDSSRIMSHLISPPQRYLLETLYGEIKVYKHVTVLTETVVNIDENTI LEISQVIGAVKNIIEIDDGLIIFGDFGIFISHKNPEKFEKFIYYYPFIRSITGVSRDLFF KLNNIASKLEVISNTLASGVDLEDITEIRGELSRIDRELAVIEIVCGYLKEIVEFLNSSY PPNFGDFDLMILEKVEAERKLRRLIYRIAEIENILKSNDSLATSLTRLLTTISEDLERKI ANQLAENTKYQVAIGEAMEVLEIGIFGVYALEAAHILLLTSGKDEILHHIKILGFPLEFW IILVVTILGVYVGKIVIEYRKKKVLGE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ1566 |
Synonyms | MJ1566; Uncharacterized protein MJ1566 |
UniProt ID | Q58961 |
◆ Recombinant Proteins | ||
Rnf168-5551M | Recombinant Mouse Rnf168 Protein, Myc/DDK-tagged | +Inquiry |
CHD5-409H | Recombinant Human CHD5 Protein, His-tagged | +Inquiry |
ARHGDIA-60C | Recombinant Cynomolgus Monkey ARHGDIA Protein, His (Fc)-Avi-tagged | +Inquiry |
CDK4-1016H | Active Recombinant Human CDK4 Protein, His-Tagged | +Inquiry |
RFL26086HF | Recombinant Full Length Human Protein Odr-4 Homolog(Odr4) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgG-336S | Native Sheep Gamma Globulin Fraction | +Inquiry |
F2-274B | Active Native Bovine α-Thrombin | +Inquiry |
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
Col4-20M | Native Mouse Collagen IV protein | +Inquiry |
Uricase-089P | Active Native Porcine Uricase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF549-54HCL | Recombinant Human ZNF549 293 Cell Lysate | +Inquiry |
ATP4B-8607HCL | Recombinant Human ATP4B 293 Cell Lysate | +Inquiry |
PNMA6A-3077HCL | Recombinant Human PNMA6A 293 Cell Lysate | +Inquiry |
CCDC24-7771HCL | Recombinant Human CCDC24 293 Cell Lysate | +Inquiry |
ABI3BP-10HCL | Recombinant Human ABI3BP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ1566 Products
Required fields are marked with *
My Review for All MJ1566 Products
Required fields are marked with *
0
Inquiry Basket