Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj0976(Mj0976) Protein, His-Tagged
Cat.No. : | RFL35960MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized protein MJ0976(MJ0976) Protein (Q58386) (1-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-366) |
Form : | Lyophilized powder |
AA Sequence : | MSEDSNPKNDLKLKMYETFRSHIERAENSFWTYMLFYLQFLVGINGAVGILCRYLSNNLQ NFPTEIIIAFLALVNILLSLIGIIVIIERGKWFFRNMILTVNLERYILKEEHIKIIPKRY SKFDNFNKVIDTTGRIFISIFIGIYMISVIALGYLANSCKTIILFGTGFFIIVVIIYFLD LLDWIYRRIDSNEYRKVIGVVLFISFIPPLMNYFIYDIINLICSYIPESFIVAMIVILIF VIIDVYYNAKKHIENTIIMLSLERTVNDIDDIIKILKNIRLDDTKKEELKKKLRKIKKLI ENVIKLLGGTSENGTQNNNLEEAKSKITEACRKISGNNIFEAINELNEAKYIINNKINEL TQSDSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ0976 |
Synonyms | MJ0976; Uncharacterized protein MJ0976 |
UniProt ID | Q58386 |
◆ Recombinant Proteins | ||
TRAPPC6B-4762R | Recombinant Rhesus Macaque TRAPPC6B Protein, His (Fc)-Avi-tagged | +Inquiry |
YOMS-3762B | Recombinant Bacillus subtilis YOMS protein, His-tagged | +Inquiry |
IGFBP7-1605H | Active Recombinant Human IGFBP7 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
PENK-4375R | Recombinant Rat PENK Protein | +Inquiry |
CHAT-172H | Recombinant Human CHAT protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
F12-5397H | Active Native Human Coagulation Factor XII (Hageman factor) | +Inquiry |
IgG-7438M | Native Mouse IgG Fc Protein, Biotin conjugated | +Inquiry |
GGT1-5353H | Native Human Gamma-Glutamyltransferase 1 | +Inquiry |
F10-63H | Native Human Factor X | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL11-2228HCL | Recombinant Human RPL11 293 Cell Lysate | +Inquiry |
MLX-4287HCL | Recombinant Human MLX 293 Cell Lysate | +Inquiry |
GPRIN3-5767HCL | Recombinant Human GPRIN3 293 Cell Lysate | +Inquiry |
BBOX1-001HCL | Recombinant Human BBOX1 cell lysate | +Inquiry |
C14orf1-8294HCL | Recombinant Human C14orf1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ0976 Products
Required fields are marked with *
My Review for All MJ0976 Products
Required fields are marked with *
0
Inquiry Basket