Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj0107(Mj0107) Protein, His-Tagged
Cat.No. : | RFL35356MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized protein MJ0107(MJ0107) Protein (Q57571) (1-525aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-525) |
Form : | Lyophilized powder |
AA Sequence : | MREIMKILIITGKLAERKVKDAVKKYDFIDVHVANISVAAFLTPNLIIKEIKKLENKLGK KLKDIYDFVLVTGLIRHDLKNVEEETGIKCFKSTREASDIPILIENLDKIKLSTKEYADL QLLEIIRKKCEEEIKKAEEQELGEGDIKIGKLKVGDKFPMRVLGEIVHAPWLKEKELEEK IIYYLESGADMIDLGMVSNENNADKIKDMLKIARDLTDNPISVDTLNTKELIEAINLGAD MILSVDAGNLDELIPYLKDSETAVVVLPTNYKTNYVPETIEGKIKSLEENIKKLIDAGIE KIVADPILEPINNAGCSFIESVIACREFKKRNKLPLFFGVGNVTELFDADSNGVNALLAA IGAEIGANILFTPEASAKCKFSIKELKIASKMMFLAKKRNSLPKDIGYNLINYKDKRFEE EITFNSYNIPIIKAEEDERQILDEGSFKIEIDRKNKEIVAIYFNKRREPVLIIRGKKPKE IYETAIRLNLIKKLDHASYFGRELAKAEIALRIGKKYNQDFDLFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ0107 |
Synonyms | MJ0107; Uncharacterized protein MJ0107 |
UniProt ID | Q57571 |
◆ Recombinant Proteins | ||
IFIH1-3H | Recombinant Human IFIH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COA3-512H | Recombinant Human COA3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OAS2-11042M | Recombinant Mouse OAS2 Protein | +Inquiry |
MPDU1-3498H | Recombinant Human MPDU1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COPS7A-1891M | Recombinant Mouse COPS7A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
C3d-48HB | Native Human Complement C3d Protein, Biotinylated | +Inquiry |
LOC102577615-62P | Native potato LOC102577615 Protein | +Inquiry |
LDHC-28045TH | Native Human LDHC | +Inquiry |
B. pertussis-36 | Native B. pertussis Filamentous Hemagglutinin Antigen | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DARS2-7072HCL | Recombinant Human DARS2 293 Cell Lysate | +Inquiry |
AGL-8980HCL | Recombinant Human AGL 293 Cell Lysate | +Inquiry |
RAB3B-522HCL | Recombinant Human RAB3B lysate | +Inquiry |
C20orf11-8127HCL | Recombinant Human C20orf11 293 Cell Lysate | +Inquiry |
Colon-99H | Human Colon Tumor Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ0107 Products
Required fields are marked with *
My Review for All MJ0107 Products
Required fields are marked with *
0
Inquiry Basket