Recombinant Full Length Methanocaldococcus Jannaschii Putative Flagella-Related Protein G(Flag) Protein, His-Tagged
Cat.No. : | RFL9871MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Putative flagella-related protein G(flaG) Protein (Q58308) (1-154aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-154) |
Form : | Lyophilized powder |
AA Sequence : | MIYLASSAMSEIVMFVAVLLIAAFVAGILTTSTYKISLNINKKGDALATKLSQDFEIIND PGDIVRNSSAGTIALYIKNTGKDPIIFTNDSFTVIIDGSIVEINTTNQLTSPGSNILSPG DVGEIVVNYNETGYHRIKVISECGISRIIRGYIS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | flaG |
Synonyms | flaG; MJ0898; Putative flagella-related protein G |
UniProt ID | Q58308 |
◆ Recombinant Proteins | ||
CADM1-2260H | Recombinant Human CADM1 Protein, MYC/DDK-tagged | +Inquiry |
ENOX1-28568TH | Recombinant Human ENOX1, His-tagged | +Inquiry |
USP30-363H | Recombinant Human USP30 Protein, GST-tagged | +Inquiry |
IL7-171H | Active Recombinant Human IL7 Protein (Asp26-His177), C-His tagged, Animal-free, Carrier-free | +Inquiry |
LAMB2-5741C | Recombinant Chicken LAMB2 | +Inquiry |
◆ Native Proteins | ||
Lectin-1794A | Active Native Artocarpus integrifolia Jacalin Protein, Fluorescein labeled | +Inquiry |
TF-102H | Native Human Transferrin (HOLO) | +Inquiry |
LDH2-20H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
BCHE-8E | Active Native Equine Butyrylcholine esterase | +Inquiry |
ORM1-8013H | Native Human Serum Alpha-1-Acid GlycoProtein | +Inquiry |
◆ Cell & Tissue Lysates | ||
INSIG2-5192HCL | Recombinant Human INSIG2 293 Cell Lysate | +Inquiry |
Testis-514R | Rhesus monkey Testis Membrane Lysate | +Inquiry |
STMN2-1396HCL | Recombinant Human STMN2 293 Cell Lysate | +Inquiry |
PGF-1118MCL | Recombinant Mouse PGF cell lysate | +Inquiry |
COA1-628HCL | Recombinant Human COA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All flaG Products
Required fields are marked with *
My Review for All flaG Products
Required fields are marked with *
0
Inquiry Basket